SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 222929.C5PHZ7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222929.C5PHZ7
Domain Number 1 Region: 23-196
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000435
Family Beta-D-xylosidase C-terminal domain-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 222929.C5PHZ7
Sequence length 198
Comment (Coccidioides posadasii)
Sequence
MSSLNLRSENTSQQPPTEADLKNGFTLKAAPGTDLWSKPPSTVRSNAPTITRAIALSRFQ
RARVHVSADWSTLYDQGGLVLMMEHKARKWIKTGIEFVSGRPYVSTVAKDNWADWSLAPI
SDGGGGVTIEMVRQKGALWVYVVEKREGEEIMVPVREITWAFAEEEDVKALAGVYACRPA
KEGGELDVVFRDFELEYT
Download sequence
Identical sequences C5PHZ7 E9DD34
CPSG_07996T0 222929.C5PHZ7 XP_003066295.1.1890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]