SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 222929.C5PJK6 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222929.C5PJK6
Domain Number 1 Region: 121-223
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.32e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 222929.C5PJK6
Sequence length 349
Comment (Coccidioides posadasii)
Sequence
MPSTHKKDKPWDTDDIDKWKIEEFKPEDNAGGTFAEESSFVSLFPKYREVYLKETWPIIT
RALEKHGIACTLDLVEGSMTVKTTRKTYDPAAILKARDLIKLLARSVPAPQALKILEDGT
ACDIIKIRNLVRNKERFVKRRQRILGPSGSTLKALELLTNTYLLVQGNTVAAMGPYKGLK
EVRRVVEDCMNNIHPIYHIKELMIKRELAKDPKLANESWDRFLPHFKKRTLSKRKKPFKV
TDKSKKVYTPFPPPQEKSKVDLQIESGEYFLSKDAKERARKEEIMERQREKRAEKMKEIE
KDFIPPKEDTGEKKKKKRKRQEDATDKAVDGEKKSKKRKSKEKVRTQEE
Download sequence
Identical sequences A0A0J6FF97 C5PJK6 E9DEX4
CPAT_05352 XP_003065050.1.1890 CPSG_08374T0 222929.C5PJK6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]