SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 223283.PSPTO_0610 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  223283.PSPTO_0610
Domain Number 1 Region: 74-264
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.42e-57
Family Biotin holoenzyme synthetase 0.000046
Further Details:      
 
Domain Number 2 Region: 3-56
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000196
Family Biotin repressor-like 0.0041
Further Details:      
 
Domain Number 3 Region: 268-314
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 0.000000778
Family Biotin repressor (BirA) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 223283.PSPTO_0610
Sequence length 319
Comment (Pseudomonas syringae tomato DC3000)
Sequence
MLTLLKLLADGAFHSGQVLGESLGVSRSAVWKQLQQLESDLDIEVHKVRGRGYRLATPIV
LLDPAAIVESGMPGEWSVRTYDSIDSTNAEASRLIALGAPMPLLVVAEQQTAGRGRRGRK
WVSPFAENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDMGVQGAGLKWPNDVLVGRQ
KIAGILLELIGDPADVCHVIIGVGVNVNMRASTEVDQLWTSVRLQTGAPADRNTIAARIS
SQLEALLVVHRQEGFLAFQKEWEQGHLWQGAAVKLLSGIETVEGVVLGVDSLGALRLEVN
GLEKSFSGGELSLRLRDDS
Download sequence
Identical sequences Q889Y7
223283.PSPTO_0610 gi|28867838|ref|NP_790457.1| NP_790457.1.37326 WP_011103219.1.14276 WP_011103219.1.17870 WP_011103219.1.6959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]