SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 223283.PSPTO_0837 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  223283.PSPTO_0837
Domain Number 1 Region: 9-190
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-35
Family Beta-D-xylosidase C-terminal domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 223283.PSPTO_0837
Sequence length 200
Comment (Pseudomonas syringae tomato DC3000)
Sequence
MKKLNFSELNWINTPENFSITENELVIHTSPDTDFWRGTYYGLEYNNAPGIVMRSEERFW
TLKSKVAFESNMFFDQCGMLIYIDDNNWMKSGIEYQSNGYQQLFSVVTNNGFSDWAMTNL
DRVTQTMYYRLSRRGNDFLLEHSADGKIFNMMRMFHMFQAYTTVQFGFFASSPGDSSFAA
HFSEIEWTECLWDAHTSSRF
Download sequence
Identical sequences F3GHK5 F3IMT7 Q889B7
223283.PSPTO_0837 NP_790682.1.37326 WP_003319037.1.12126 WP_003319037.1.14276 WP_003319037.1.17870 WP_003319037.1.47305 WP_003319037.1.60753 WP_003319037.1.6959 WP_003319037.1.80269 WP_003319037.1.87092 gi|28868063|ref|NP_790682.1| PsR7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]