SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 223283.PSPTO_5334 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  223283.PSPTO_5334
Domain Number 1 Region: 3-256
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 3.85e-83
Family Histidine biosynthesis enzymes 0.000000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 223283.PSPTO_5334
Sequence length 256
Comment (Pseudomonas syringae tomato DC3000)
Sequence
MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGR
DTTLHTVERMASQVFIPLTVGGGVRTVQDIRNLLNAGADKVSINTAAVFNPEFVGEAAAR
FGSQCIVVAIDAKRVSGPGEAPRWEIFTHGGRKPTGLDAVLWAKKMEDLGAGEILLTSMD
QDGMKNGFDLGVTRAISDALGIPVIASGGVGNLEHLAAGVIEGHASAVLAASIFHFGEYT
VPEAKAYMASRGIVVR
Download sequence
Identical sequences A0A0N0WX13 A0A0Q0C730 F3IJ15 Q87UG4
223283.PSPTO_5334 gi|28872446|ref|NP_795065.1| NP_795065.1.37326 WP_005767116.1.12126 WP_005767116.1.14276 WP_005767116.1.17870 WP_005767116.1.45653 WP_005767116.1.6959 WP_005767116.1.7265 WP_005767116.1.80269 WP_005767116.1.87092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]