SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 224308.BSU20710 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  224308.BSU20710
Domain Number - Region: 6-33
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00667
Family Mitotic arrest deficient-like 1, Mad1 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 224308.BSU20710
Sequence length 67
Comment (Bacillus subtilis)
Sequence
MTSEMQLQAQIDVIEKENKELRRRNEELGQTVECQNKQIVTQNWRLLFFASSWIVYGIVS
AIKYLWG
Download sequence
Identical sequences A0A1P8CWX9 O34509 O64109
gi|16079130|ref|NP_389953.1| 224308.BSU20710 O64109_BPSPB gi|402776323|ref|YP_006630267.1| gi|470162267|ref|YP_007534042.1| gi|9630221|ref|NP_046648.1| NP_046648.1.20604 NP_389953.1.22788 WP_009967502.1.11257 WP_009967502.1.1140 WP_009967502.1.15902 WP_009967502.1.16291 WP_009967502.1.27660 WP_009967502.1.2914 WP_009967502.1.32420 WP_009967502.1.33846 WP_009967502.1.36189 WP_009967502.1.40859 WP_009967502.1.44184 WP_009967502.1.45019 WP_009967502.1.47157 WP_009967502.1.56274 WP_009967502.1.56411 WP_009967502.1.57201 WP_009967502.1.5726 WP_009967502.1.57513 WP_009967502.1.6517 WP_009967502.1.65223 WP_009967502.1.72999 WP_009967502.1.76977 WP_009967502.1.81116 WP_009967502.1.81747 WP_009967502.1.91723 WP_009967502.1.93420 WP_009967502.1.94199 WP_009967502.1.96043 WP_009967502.1.979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]