SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 224308.BSU22660 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224308.BSU22660
Domain Number 1 Region: 12-247
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 3.18e-73
Family Tryptophan biosynthesis enzymes 0.0000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 224308.BSU22660
Sequence length 249
Comment (Bacillus subtilis)
Sequence
MLEKIIKQKKEEVKTLVLPVEQPFEKRSFKEALASPNRFIGLIAEVKKASPSKGLIKEDF
VPVQIAKDYEAAKADAISVLTDTPFFQGENSYLSDVKRAVSIPVLRKDFIDSLQVEESRR
IGADAILLIGEVLDPLHLHELYLEAGEKGMDVLVEVHDASTLEQILKVFTPDILGVNNRN
LKTFETSVKQTEQIASLVPKESLLVSESGIGSLEHLTFVNEHGARAVLIGESLMRQTSQR
KAIHALFRE
Download sequence
Identical sequences A0A162SAG3 A3F3C9 P03964
gi|255767488|ref|NP_390147.3| NP_390147.3.22788 WP_010886553.1.11257 WP_010886553.1.1140 WP_010886553.1.15902 WP_010886553.1.16291 WP_010886553.1.33846 WP_010886553.1.36189 WP_010886553.1.45019 WP_010886553.1.57201 WP_010886553.1.6139 WP_010886553.1.65223 WP_010886553.1.72999 WP_010886553.1.81116 WP_010886553.1.96043 WP_010886553.1.979 224308.BSU22660 gi|402776524|ref|YP_006630468.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]