SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 224308.BSU27030 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224308.BSU27030
Domain Number 1 Region: 29-350
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.41e-114
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000000359
Further Details:      
 
Domain Number 2 Region: 349-513
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-39
Family Glycosyl hydrolases family 32 C-terminal domain 0.00033
Further Details:      
 
Weak hits

Sequence:  224308.BSU27030
Domain Number - Region: 545-648
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00927
Family Galectin (animal S-lectin) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 224308.BSU27030
Sequence length 677
Comment (Bacillus subtilis)
Sequence
MKKRLIQVMIMFTLLLTMAFSADAADSSYYDEDYRPQYHFTPEANWMNDPNGMVYYAGEY
HLFYQYHPYGLQWGPMHWGHAVSKDLVTWEHLPVALYPDEKGTIFSGSAVVDKNNTSGFQ
TGKEKPLVAIYTQDREGHQVQSIAYSNDKGRTWTKYAGNPVIPNPGKKDFRDPKVFWYEK
EKKWVMVLAAGDRILIYTSKNLKQWTYASEFGQDQGSHGGVWECPDLFELPVDGNPNQKK
WVMQVSVGNGAVSGGSGMQYFVGDFDGTHFKNENPPNKVLWTDYGRDFYAAVSWSDIPST
DSRRLWLGWMSNWQYANDVPTSPWRSATSIPRELKLKAFTEGVRVVQTPVKELETIRGTS
KKWKNLTISPASHNVLAGQSGDAYEINAEFKVSPGSAAEFGFKVRTGENQFTKVGYDRRN
AKLFVDRSESGNDTFNPAFNTGKETAPLKPVNGKVKLRIFVDRSSVEVFGNDGKQVITDI
ILPDRSSKGLELYAANGGVKVKSLTIHPLKKVWGTTPFMSNMTGWTTVNGTWADTIEGKQ
GRSDGDSFILSSASGSDFTYESDITIKDGNGRGAGALMFRSDKDAKNGYLANVDAKHDLV
KFFKFENGAASVIAEYKTPIDVNKKYHLKTEAEGDRFKIYLDDRLVIDAHDSVFSEGQFG
LNVWDATAVFQNVTKES
Download sequence
Identical sequences A0A164X0F8 L8AM98 P05656
gi|16079757|ref|NP_390581.1| 224308.BSU27030 gi|470162913|ref|YP_007534688.1| NP_390581.1.22788 WP_004398804.1.11231 WP_004398804.1.11257 WP_004398804.1.1140 WP_004398804.1.12759 WP_004398804.1.15902 WP_004398804.1.16291 WP_004398804.1.19261 WP_004398804.1.25531 WP_004398804.1.27372 WP_004398804.1.27660 WP_004398804.1.2914 WP_004398804.1.31100 WP_004398804.1.32219 WP_004398804.1.32420 WP_004398804.1.33846 WP_004398804.1.36189 WP_004398804.1.39605 WP_004398804.1.40859 WP_004398804.1.44140 WP_004398804.1.44184 WP_004398804.1.45019 WP_004398804.1.47157 WP_004398804.1.56274 WP_004398804.1.56411 WP_004398804.1.57184 WP_004398804.1.57201 WP_004398804.1.5726 WP_004398804.1.57513 WP_004398804.1.6139 WP_004398804.1.6517 WP_004398804.1.65223 WP_004398804.1.72516 WP_004398804.1.72999 WP_004398804.1.76977 WP_004398804.1.78686 WP_004398804.1.79712 WP_004398804.1.81116 WP_004398804.1.81747 WP_004398804.1.82722 WP_004398804.1.88042 WP_004398804.1.91723 WP_004398804.1.93420 WP_004398804.1.94199 WP_004398804.1.95009 WP_004398804.1.96043 WP_004398804.1.979 gi|402776855|ref|YP_006630799.1| gi|560129660|ref|YP_008830801.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]