SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 224308.BSU38040 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224308.BSU38040
Domain Number 1 Region: 24-338
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.51e-112
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000751
Further Details:      
 
Domain Number 2 Region: 340-478
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-19
Family Glycosyl hydrolases family 32 C-terminal domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 224308.BSU38040
Sequence length 479
Comment (Bacillus subtilis)
Sequence
MTAHDQELRRRAYEEVEKKEPIANSDPHRQHFHIMPPVGLLNDPNGVIYWKGSYHVFFQW
QPFQTGHGAKFWGHYTTQDVVNWKREEIALAPSDWFDKNGCYSGSAVTKDDRLYLFYTGN
VRDQDGNRETYQCLAVSDDGLSFEKKGVVARLPEGYTAHFRDPKVWEHEGTWYMVIGAQT
ENLKGQAVLFASDNLTEWRFLGPITGAGFNGLDDFGYMWECPDLFSLQGSDVLIVSPQGL
EADGFRYQNVYQSGYFVGRLDYNKPELKHGEFTELDQGFDFYAPQTLEDDQGRRILFAWM
AVPDQDEGSHPTIDCHWIHCMTLPRQLTLSGQKLIQQPLPELKAMRRNEKKIHINMHGSS
GALPVEKPERTEILLEDIHTESGFSISIRGTATFSFHKDEGIVTLERKSFDGKRTEARHC
RIKDLHTVHMFLDASSVEIFINNGEEVLSARYFPFPGNHEVTASATGKSEMNVGIWTLM
Download sequence
Identical sequences A0A164UN16 A0A1B2B7X5 P07819
NP_391683.2.22788 WP_010886636.1.1140 WP_010886636.1.57201 WP_010886636.1.6139 WP_010886636.1.65223 WP_010886636.1.81116 224308.BSU38040 gi|255767804|ref|NP_391683.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]