SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 224324.aq_067 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224324.aq_067
Domain Number 1 Region: 1-160
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.51e-55
Family Ferredoxin domains from multidomain proteins 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 224324.aq_067
Sequence length 170
Comment (Aquifex aeolicus)
Sequence
MKRPIMLIDLDRCIGCLSCEVACVQEKGLESLYIRPMKVFRVEGISEEPGAFYYPMNCFH
CDPAPCVVACPTSAMRKREKDGIVYVEQTLCIGCKACIIACPYGAITFNPATQKVEKCDY
CYKRVDKGLLPSCVEKCVTNCLYFVEVDEVPKERHKLKRIDEKLYEEIFS
Download sequence
Identical sequences O66481
gi|15605666|ref|NP_213041.1| NP_213041.1.100253 224324.aq_067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]