SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 224324.aq_221 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224324.aq_221
Domain Number 1 Region: 297-493
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.68e-47
Family Ribonuclease PH domain 1-like 0.0000397
Further Details:      
 
Domain Number 2 Region: 14-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-43
Family Ribonuclease PH domain 1-like 0.0001
Further Details:      
 
Domain Number 3 Region: 449-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.37e-29
Family Ribonuclease PH domain 2-like 0.0000925
Further Details:      
 
Domain Number 4 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.81e-28
Family Ribonuclease PH domain 2-like 0.00082
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 6 Region: 239-318
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000173
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0021
Further Details:      
 
Domain Number 7 Region: 703-770
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000178
Family Cold shock DNA-binding domain-like 0.0017
Further Details:      
 
Domain Number 8 Region: 620-688
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000596
Family Cold shock DNA-binding domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 224324.aq_221
Sequence length 775
Comment (Aquifex aeolicus)
Sequence
MSVEEKARIGNSEEPIIIETGKYAKLTDGSVVVRQGGTAVLVTAVMSDEPITDVDFTPLA
VDYRERASAYGRIPGGFTKREGKPTDREILVSRVIDRPIRPLFPEGFFHDVIITALTLSA
DDKYDPDVLAITGASAALHISRIPFEGPIAGVRVCRVNGEFVANPTYEQRKEADLDIVMA
GTKDAIVMVEGGGKEIPEEVLADALFFGLDAIKEVIEAQERLREKVGKPKFEYQKVELPE
DILKALEEECTPKILEAFNIKDKKERYSTLDKIVEEFIEAHQIPEELHFAVKYFYKKLES
RLMREKVLKEGVRIDGRKPNEIRPIWIEVHPFERPHGNAIFTRGQTQAYVTVTLGTPDEA
LIIETIAEGEVFKRFMLHYSMPPFSVGEAKPWGPPRRREIGHGALAERAIEPLLPPEEEY
PFIIRVVSDILESNGSTSMATVCGASLALFDAGVPMKDNKHVAGIAMGLILEKDRYVILS
DILGDEDHLGDMDFKVAGTKDGITSVQMDIKVKGITKEIMLDALKQAREGRLYILEKMYE
AIPEPRKEPHPYTPKVEVVDVPEEKAPLIIGPGGSTVKKIYDETGVKVWVGEQGKVYLFV
FPGGDVEKAKQMIQDIVREVEVGAVYKGTITRVEPYGVFVELWPGKIGLLHVSKMAEPVR
SATEKYKVGEEIIVKVLDLDELGRPRFTTIGIEDVGTEKKEVKPKVGDVYEGKVVRVEPY
GAFIEYAPGKVGLLHVSKMKERVKDARQKYKVGDVVKVKVVEIDEQGRPKFTDDV
Download sequence
Identical sequences O66593
NP_213153.1.100253 gi|15605776|ref|NP_213153.1| 224324.aq_221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]