SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 224325.AF0239 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224325.AF0239
Domain Number 1 Region: 3-158
Classification Level Classification E-value
Superfamily PRTase-like 3.54e-43
Family Phosphoribosyltransferases (PRTases) 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 224325.AF0239
Sequence length 194
Comment (Archaeoglobus fulgidus)
Sequence
MKFKCVLYTWDEIRKLCKELAMKVRESGYQPDAVVAIARGGWVPARIVCDYLDIRELYSV
KTEHWDVAEKREEAKITQPLNVDVSGKKILIVDDVADTGDTIRVVVDHVNQYRPAEIRVA
VVDYKTTSKFVPDYYAAKMEAWRWIVYPWSVKEELRDLIEKVNAKTVDEAVRALKEEFDL
EVDEELVRDVLTDC
Download sequence
Identical sequences A0A075WAQ9 A0A101DFF7 O30000
gi|11497855|ref|NP_069077.1| WP_010877750.1.27515 WP_010877750.1.34637 WP_010877750.1.46508 224325.AF0239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]