SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 224325.AF1296 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224325.AF1296
Domain Number 1 Region: 83-174
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.83e-23
Family HSP20 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 224325.AF1296
Sequence length 174
Comment (Archaeoglobus fulgidus)
Sequence
MVWRRRRRDWDEEWDIFDEFFRFGIDDIFERMMRDIEEIFRKAESGEIKPIVRGFSIRIG
PDGKPEIREFGTKPTIKETGIEERRPLVDVIETDNEIQVIAEMPGVNKDDIELNATETTL
EIRAEGENRKYYETVELPAEVDPDSAKARYNNGVLEVILKKKTPKTSGKKIKIE
Download sequence
Identical sequences A0A075WDW0 A0A101DCK8 O28973
224325.AF1296 gi|11498894|ref|NP_070125.1| WP_010878792.1.27515 WP_010878792.1.34637 WP_010878792.1.46508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]