SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 224325.AF1653 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224325.AF1653
Domain Number 1 Region: 109-225
Classification Level Classification E-value
Superfamily Subtilisin-like 7.46e-46
Family Subtilases 0.0000607
Further Details:      
 
Weak hits

Sequence:  224325.AF1653
Domain Number - Region: 45-82
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0179
Family Subtilase propeptides/inhibitors 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 224325.AF1653
Sequence length 270
Comment (Archaeoglobus fulgidus)
Sequence
MMSIRTIIIMSLVIIVSLQTAAGVPVIIKVADGYLDDVAATMHGAKKIELFSVIAADLSE
DEIKKLSENPYVEGVYPDVDVKAVDEIQMLSMPDLFSTTATSVSEADVWNLDFINVSGVW
KMGYKGSGVKVAVIDTGVARHPDFADRIVAFADFVNGQTEPYDDNGHGTHVAGTIAGEIT
GVAPEAEIMAAKVLDSRGSGKLSTVLMGIQWAYENGADVISMSLGALPGLGGATEKFSTQ
ERATKLIFRFIRASEKFTMTWTTSCRVTLS
Download sequence
Identical sequences O28620
224325.AF1653 gi|11499243|ref|NP_070481.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]