SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 224326.BB_S40 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224326.BB_S40
Domain Number 1 Region: 56-239
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 8.54e-18
Family Lambda integrase-like, catalytic core 0.01
Further Details:      
 
Weak hits

Sequence:  224326.BB_S40
Domain Number - Region: 19-53
Classification Level Classification E-value
Superfamily BLRF2-like 0.0719
Family BLRF2-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 224326.BB_S40
Sequence length 258
Comment (Borrelia burgdorferi)
Sequence
MDNNNSFNLNNFNMDFTLKLFQEYQKLINENKILKNSLKNSSKSKKENSKPTPKFYLTPK
SIKLILKCAKTLKQIDPISGWFVHLLLISGCRGTEMQKVKMQDISTFLSKTGKTLYTIKV
NVAKKRNTSCIREIVINSEEFEAIQTAHKNHFQEKTLDSRRTYLFQKSKHKFKDNQIDIV
HISKKFKNLLKKSGFRVNKSLHLCRNLFISNLKSNGYNSFQIKELMKYSSTNEIDNIYGL
SSANKIQAYECAKKCLKL
Download sequence
Identical sequences A0A0E0SSX8 H7C7M7 Q44750
gi|11497121|ref|NP_051243.1|NC_000949 gi|223987678|ref|YP_002601206.1|NC_012106 gi|11497121|ref|NP_051243.1| NP_051243.1.46978 WP_010883761.1.1709 WP_010883761.1.23946 WP_010883761.1.58911 WP_010883761.1.75039 WP_010883761.1.7957 WP_010883761.1.86244 224326.BB_S40

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]