SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 224911.bll0779 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224911.bll0779
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.14e-51
Family Ribonuclease PH domain 1-like 0.0000158
Further Details:      
 
Domain Number 2 Region: 294-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-49
Family Ribonuclease PH domain 1-like 0.0000097
Further Details:      
 
Domain Number 3 Region: 145-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.02e-29
Family Ribonuclease PH domain 2-like 0.0012
Further Details:      
 
Domain Number 4 Region: 451-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.22e-26
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 5 Region: 555-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.18e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 
Domain Number 6 Region: 621-701
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.45e-20
Family Cold shock DNA-binding domain-like 0.00057
Further Details:      
 
Domain Number 7 Region: 238-321
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.44e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 224911.bll0779
Sequence length 720
Comment (Bradyrhizobium japonicum)
Sequence
MFNKHSVEIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKAPREGVDFLPLT
VDYQEKTYAAGRIPGGYFKREGRPTEKETLVSRLIDRPIRPLFVDGWRNETQVIATVLSH
DMENDPDIVALVASSAALTLSGAPFKGPIGAARVGFVNDEYVLNPTLDEMVDTQLDLVVA
GTADAVLMVESEAKELNEDIMLGAVMFGHRHFQPVINAIIELAEKAAKEPREVTVIDNAA
LEKEMLGLVEQELRAAYAIPVKQDRYAAVGKVKEKVIAHYFPEGQEPKYDKLRIAGVFKE
LEAKIVRWNILDTGKRIDGRDSKTVRNIIAEVGVLPRAHGSALFTRGETQAMVVTTLGTG
EDEQYIDALSGTYKETFLLHYNFPPYSVGETGRLGGTKRREIGHGKLAWRAIHPVLPPHH
EFPYTIRVVSEITESNGSSSMASVCGASLALMDAGVPLKRPTAGIAMGLILEDKRFAVLS
DILGDEDHLGDMDFKVAGTESGITSLQMDIKIEGITEEIMKVALGQAKDGRIHILGEMAK
ALTNARAELGEYAPRIETFKIPTDKIREVIGTGGKVIREIVEKTGAKVNIEDDGTVKVAS
SDGEAMKAAIKWIKSIASEPEVGQIYDGTVVKVMEFGAFVNFFGSKDGLVHISQLASARV
QKTSDVVKEGDKVKVKLLGFDDRGKTRLSMKVVDQTTGEDLEAKDKVAEGEKAPREAAGE
Download sequence
Identical sequences A0A2A6N6H3 Q89WB3
NP_767419.1.11505 WP_011083601.1.15658 WP_011083601.1.90507 gi|27375890|ref|NP_767419.1| 224911.bll0779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]