SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 224911.bll1007 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224911.bll1007
Domain Number 1 Region: 1-223
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 9.52e-51
Family Glyoxalase II (hydroxyacylglutathione hydrolase) 0.0022
Further Details:      
 
Domain Number 2 Region: 218-345
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.06e-22
Family Single-domain sulfurtransferase 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 224911.bll1007
Sequence length 345
Comment (Bradyrhizobium japonicum)
Sequence
MIFRQLFDSVSGTYSYVLASRHGGEALILDPVLEKVDRYCQLLRELDLKLVKAVDTHLHA
DHVTGLGELRDRTHCMTVMGDQTKADVVAMRVADGDKVTIEGLSLDVMYTPGHTDDSYSY
LMGDRVFTGDTLLIRGTGRTDFQNGSSRAQYDSIFNRLLKLPDETMVFPAHDYKGDTVST
IGEEKRYNPRLQVRSVDEYIELMANLKLPNPKMMDVAVPANMRVGLHQEELEKEGRALTA
SEAIRVLGRPDILLVDLRETNERMKHGMLEGALHTPYPSVEESLKPGGMLREVAAATGRR
IVFFCAFGERSAMAVAAAKEAGLANTAHIAGGIDAWKKAGGPVVH
Download sequence
Identical sequences A0A0E4BND4 A0A0M9BHE3 Q89VN8
gi|27376118|ref|NP_767647.1| 224911.bll1007 NP_767647.1.11505 WP_011083827.1.15658 WP_011083827.1.2739 WP_011083827.1.53516 WP_011083827.1.53518 WP_011083827.1.67972 WP_011083827.1.69380 WP_011083827.1.90507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]