SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 224911.bll2665 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224911.bll2665
Domain Number 1 Region: 79-612
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 6.98e-121
Family Arylsulfatase 0.0000068
Further Details:      
 
Weak hits

Sequence:  224911.bll2665
Domain Number - Region: 647-781
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.029
Family Laminin G-like module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 224911.bll2665
Sequence length 819
Comment (Bradyrhizobium japonicum)
Sequence
MNFRAIVSILFLTSAISAPAFAQQAQPTTPPPGSPAATITIPGNQLPPPDPKFGGVIKDK
ASESTPWWPPRVVPPKGAPNVLVIMTDDQGFGAPSTFGGIIPTPSMDRIAKAGLRYTNFH
STSLCSPTRAALITGRNHHSVGYGVVGEIATGFPGYDSIIPIEKGTIGTILKANGYATSW
FGKDHNTPSYQSSQAGPFDQWPNGMGFDYFYGFVGGDASQWQPNLFRNTTAIYPFQGNPG
WNLETAMADEAIQHMKQLKEVAPDKPFFVYYVPGATHAPHHPTPEWVKKISDMHLFDEGW
NKVRETIFANQKRLGIMPENAKLTPWPKDLPEWDSLSWDEKKLFIKQADIYGAYLAYADH
EIGRVIQAVEDLGELNNTLIIYIGGDNGASAEGMLNGTPNEFTTFNGVPVPVKDQLLWYP
FWGSERTFPHFAAGWAWTMDTPFKWVKQVPSHFGGTAQGVVMSWPGHITDVGGIRRQFHH
VIDIVPTILEATGISQPDTINGIKQIPIEGVGMTYTWDKANANTASRHTTQYFEMLGNRA
IYQDGWVAATTPATLPWELSTKTPPDVITGYNWELYNVQEDPTQFNDLAAKMPDKLKQMK
DLFYAEAKKYNVLPLDNSTLARWNTPRPSLTAGRTVFTYSGELIGTPASAAPDILNKSYS
ITAEVDIPEGGAEGMIVTHGGRFGGYGLFLSKGEFGVGRGKVVFLYNLLDLKRTTWEGPE
LSAGKHTIAFDFKPDEPGLGKGGTGVLSVDGKEVARNSLEHTIPVTFPEDETFDVGQDTR
TGVALVEYRYDTPFKFTGKINKLTFKLEPEPKSQTTGKN
Download sequence
Identical sequences A0A2A6NA08 Q89RU7
NP_769305.1.11505 WP_011085450.1.15658 224911.bll2665 gi|27377776|ref|NP_769305.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]