SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 224911.blr3549 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224911.blr3549
Domain Number 1 Region: 76-277
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000103
Family Clostridium neurotoxins, the second last domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 224911.blr3549
Sequence length 753
Comment (Bradyrhizobium japonicum)
Sequence
MIYRTNEYLGYPDRISVPAGETVRFQLSSKRPNVKVEVLRLRCGDVDVNGPGFKYEVMTS
NVDGEHACLDQPIRPGSNAIVEHDGALAPTGGHWCFGAYVCPTRIADNAKAVMGNWCEAS
GRGYALELDEEGCPVLVLGQSTGASARFTLDVKLRQRVWAFVSVAIDLVRRSATLSLIVP
ANGVQPTVAHAKSFALPLALALDSGLPFLIAAHHLNGEQQYASHFDGKIEAPRIFSRPLE
AEALRVFDCQPRTGATEAGLVAFWDFADGISTLSVKDLSPNGLHGSLRQLPRRGVTGFHW
SGSVHDWRLSPREYAAIHFHSDDIYDCGWQTTCALDVPADWRSGVYALRLTPGGNDPEAN
CESYVTFFVTPGRKSRRADFVIVASVATYLAYANSALRLYQVHFETLMEHVLWLPQDDVF
MQENPEIGQSTYDCHVDGSGRAYSSWLRPILNMRPRGYWFNLINDTHILDWLEEKGISYD
LITDVELDREGARALAPYRVVMTPTHPEYYSFSMMNAIMAHQNAGGRHISMGGNAFYWRC
GFHPAAPAALEVRRGMAGTRTWESEPGEVHLAGTGEPGSLWRHSGFAPQKLVGVGFSAMI
NDTCGYYLRTAESEDARAAFIFEGVDRDEKLGDFGFRYNGAVGSEIDRYDLDLGTPRHAL
RIATSEGLGAGALPTPEEFRTVVDGLDGTQNALVRADMVFFETANGGAVFATGSITYGVS
LGHNNYDNNISAITLNVVTRFLDPAPFVIPAQA
Download sequence
Identical sequences A0A2A6N7J3 Q89PD3
gi|27378660|ref|NP_770189.1| NP_770189.1.11505 WP_011086331.1.15658 WP_011086331.1.90507 224911.blr3549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]