SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 224911.blr3814 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224911.blr3814
Domain Number 1 Region: 191-277
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.22e-18
Family CAP C-terminal domain-like 0.024
Further Details:      
 
Domain Number 2 Region: 58-188
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.24e-17
Family cAMP-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 224911.blr3814
Sequence length 282
Comment (Bradyrhizobium japonicum)
Sequence
MRTRAASLTFVGTGARIAGFMTAAPGAPWVQFMQTERLRVPSDTIRAALVRRLRVSSGIS
EEDVREIEALPIAVRQYPAETPVVRDGERATECCLIVEGFCARSKTIASGKRQILSLHIP
GEIPDLMSLFLHVMDHELSTLTPCTLGFISHDTLRRLHQRRPVVAEMFWRDTLIDAAMFR
EWIVNVGQRPAPARLAHVMIELRERLRVIGRVDGNTFEMPLTQEQIGEALGITAVHANRV
IKQLRQEGIVEFQRGRVTVLDEQKFFELADFDGRYLHQSPTL
Download sequence
Identical sequences Q89NM4
gi|27378925|ref|NP_770454.1| NP_770454.1.11505 WP_011086595.1.15658 WP_011086595.1.90507 224911.blr3814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]