SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 224911.blr5318 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224911.blr5318
Domain Number 1 Region: 102-183
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 0.0000000777
Family Lambda integrase-like, catalytic core 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 224911.blr5318
Sequence length 188
Comment (Bradyrhizobium japonicum)
Sequence
MPRFTDRFVASLKAEGAERFEVKDDACKGLAIRVTASRKTFCFRFKRHGKMQRITLGEYP
LMTLAQAVIAANRRYADLHEGRNPIAEAQREAAEASVGADELTFNRLADRYVNEYAKPRK
KSWKDDEWVLKRAKAEFGPRIVSTITRKELVVFLRGLAATSVRNANKTQASICTMYNWAS
RAQAAHRS
Download sequence
Identical sequences Q89JG5
gi|27380429|ref|NP_771958.1| 224911.blr5318 NP_771958.1.11505 WP_011088074.1.15658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]