SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 224911.blr6726 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224911.blr6726
Domain Number 1 Region: 833-1029
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.44e-44
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000634
Further Details:      
 
Domain Number 2 Region: 298-499
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 3.27e-44
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000774
Further Details:      
 
Domain Number 3 Region: 137-183,276-332
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 3.92e-28
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0014
Further Details:      
 
Domain Number 4 Region: 40-132
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 4.71e-27
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000873
Further Details:      
 
Domain Number 5 Region: 565-672
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.46e-26
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00081
Further Details:      
 
Domain Number 6 Region: 724-808
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 6.54e-21
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00072
Further Details:      
 
Domain Number 7 Region: 673-723,810-859
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 4.24e-20
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0013
Further Details:      
 
Domain Number 8 Region: 184-274
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 1.22e-18
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 224911.blr6726
Sequence length 1052
Comment (Bradyrhizobium japonicum)
Sequence
MISKFFIERPVLSNVIALLMILIGGVALFNLAIAQYPDVVPPTVQVTTRYPGASAKTVID
TVALPIEQQVNGVEDMLYMQSYSGSDGTYTLTVTFKIGTDLNFAQVLVQNRVSSALSQLP
TSVQNQGVTVQKKSTSILLFVTLTSPDSRFDSLYLSNYATINIRDELSRLPGVGNVTVFG
AGQYSMRVWLDPNKLQVRGLVPQDVIQAIQQQSQQVSAGQVGAPPTPPGQAFQYTLNVNG
RLDDTSQFENIIVKSGTSGDVTRVRDVGWVELGAQTYSQIFSLNKQPAVGIGVFQSPGAN
ALQVEQAVEKKMAELAKRFPEGIKYDTPFDTTKFVEASVHEVYMTLIEAGLLVLVVMLVF
LQDWRAMLVPATTVPVTIIGAFAAMAALGFTINMSTLFAIVLAIGIVVDDAIVVVEGAAH
NIEQGMNGHDAAIKAMDQLFAPIVGITLVLISVFLPASFLAGLTGRIYSQFALVIAATAL
LSAINAATLKPTQCALWLRPAVPPEQRNFFYRGFNNVYDRVERGYTRLITFLVRHATVSV
AVALVLIGIGGYGLSRVPTGFLPIEDQGYLIAAIQLPDGASLERTQKVLDRASEIIKETP
GVQQVITIAGISALDSSASLANAGVAYIILKDWDARKGPGEDLRSLVYGLNDKLAVIMEA
RTIVLPPPPIQGIGNAAGFSMQVELRDGNSDFAKLQAITGAVVSNGQSQSALQRVQSSFR
SSVPQFNVEIDRVKTQTLHVTTDQVFSALSTYLGSSFVNQFNKFGRVFQVYTQADPAFRV
TERDIANMMVRNSNGDMIPIGTVATITPATGPSLISLYNLYPSSTIIGLPAQGYSSGQSL
KLMEEIADKTLPPGTGYEWTAMSYQEKAVSNQIYWVFGLAMLLVYLVLAGQYESWYAPIS
VILAVPLSLIGPMLILNGLKIDNNLYCQIGLILLIALSAKNAILIVEVGLELHGRDGKPI
LESAIEAARARFRPILMTSFAFILGVVPLVIATGAGASARKSIGITVFSGMLASTCLAVL
FVPAFFVVVQRFENWRASKKAPKVQPAVEVKP
Download sequence
Identical sequences Q89FH4
224911.blr6726 gi|27381837|ref|NP_773366.1| NP_773366.1.11505 WP_011089465.1.15658 WP_011089465.1.90507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]