SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 224914.BMEI1890 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224914.BMEI1890
Domain Number 1 Region: 181-308
Classification Level Classification E-value
Superfamily DR1885-like metal-binding protein 1.1e-44
Family DR1885-like metal-binding protein 0.0022
Further Details:      
 
Weak hits

Sequence:  224914.BMEI1890
Domain Number - Region: 7-79
Classification Level Classification E-value
Superfamily Cytochrome f, large domain 0.0409
Family Cytochrome f, large domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 224914.BMEI1890
Sequence length 322
Comment (Brucella melitensis)
Sequence
MFALCASAGIASAHCSLDQKEAKAGTFYKAALRIPHGCEGKATTKVTVDLPEGFIMAQPQ
AKAGWKIETTKGDYAHGYKLHGKEVTSGVKQISWSDGNLPSDFYDEFVVVGQLAPFDKDT
TLSFPVTQFCGDAASVAWTEIAKDGQNPHDLKHPAPQLRVLAAASTDEHAGHDAMSEHMN
HAAMPTKVGDLVITDPSVRAMVPGAKVAGGFLTIANDGKKADKLVSVSAPGVKRVEIHEM
TMQDQIMKMRKLEGGLDLPAGKTMQLKSGSYHLMFIEPEHPYEEGETVPVTLEFKKAGKV
EINFPVTAKKGQTKDHSEHSSH
Download sequence
Identical sequences Q8YEI8
224914.BMEI1890 gi|17988173|ref|NP_540807.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]