SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 224914.BMEI2017 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224914.BMEI2017
Domain Number 1 Region: 10-215
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.88e-59
Family Tryptophan biosynthesis enzymes 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 224914.BMEI2017
Sequence length 227
Comment (Brucella melitensis)
Sequence
MRRKPMALDIKICGLKTPEAVAAALDGGATHIGFIFFPKSPRHITPDAAARLRAAATGRA
VAVAVTVDADDEALDEIVKTVRPDMLQLHGGETPERVRFLKERYNLPVMKAFSIREAGDL
EAIAPYRGIADRFLFDAKPPKGSELPGGNGISFDWNLLAALDADIDYMLSGGLNADNIAE
ALLKTGAPGIDISSGVECAPGEKDVRLIENFFQAVADANAQPFARRA
Download sequence
Identical sequences C4ITU4 D6LM44 D7H0L1
gi|17988300|ref|NP_540934.1| 224914.BMEI2017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]