SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 225849.swp_0164 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  225849.swp_0164
Domain Number 1 Region: 1494-1604
Classification Level Classification E-value
Superfamily CalX-like 3.27e-17
Family CalX-beta domain 0.0023
Further Details:      
 
Domain Number 2 Region: 1070-1316
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000000000000157
Family SGL-like 0.092
Further Details:      
 
Domain Number 3 Region: 558-633
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000000000161
Family Pre-dockerin domain 0.088
Further Details:      
 
Domain Number 4 Region: 1390-1492
Classification Level Classification E-value
Superfamily CalX-like 0.00000000157
Family CalX-beta domain 0.0051
Further Details:      
 
Weak hits

Sequence:  225849.swp_0164
Domain Number - Region: 740-903
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000807
Family MAM domain 0.024
Further Details:      
 
Domain Number - Region: 178-269
Classification Level Classification E-value
Superfamily Carbohydrate phosphatase 0.0687
Family Inositol monophosphatase/fructose-1,6-bisphosphatase-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 225849.swp_0164
Sequence length 1637
Comment (Shewanella piezotolerans WP3)
Sequence
MKNRLSIMSLVSLGALSFTAQAVNQSLYAKGTETNVTTSSKVAVSQNIRDIASPIRVVTK
QRKLKLEQSGEKIPGVDINKQVRNIFPFASSLRTQDKVKDPSIQSILRPNLYSLAMPTTG
VSFDGINNILGVAPPDTNGDVGPNHYVQAVNITMAIFDKEGSTLVAPFAINDLWDGFGGK
CETNNDGDPIVLYDNMADRWLISQFALDGTDNHECIAISTTGDPTGSYYLYDFAYGELMN
DYPHFGVWHDGYYMGVNQFDPTNNYSYAGGGVVAYERDKMLVGAEAKQIIFSMQGNTPDV
FTPMPLDIDGPTSPNTNLNQTIMWADGSGESKLHFAEFDVDWETPENSNIIHKTSLDVAE
WNAPDNAMQPNGIELDGMPIRSMFRAAYRNLGNRSSIVFTHNVAAADNSTPALRWYEIDL
NETSGDVSVRQQGTFAPDEKARWMGSGAMDTQGNIAFGYSVSSVDKHPSVFAATRKVDDP
LNELTSEIELKAGTGSQGNIYRNRWGDYSSMSIDPADECTFWFTTEYYKAEDDNTTAWST
NISSFKLPECQVGPSGEISGKVTDGDTETALANVVVTAAGRSTVTDAEGNYSFTVPVGDY
TLYAYKYGWEELTTAEFTVDEDESELLDVSLTSAEMVTVSGSVMDTSGQNWPLYAKVNVE
VPGDVISTFTNPETGEYSIDLVAGTAVKVAVSSNEQGYLKASENITPVNSGGSSATFAQN
FNLNINPNCTADGYELNELSFFEGFEGDVFPPAGWTTTDDATSGFTWFRATTERSISGIT
NESVGFALADSDAAGTINLDTSLISPVFNTADYTHFDLSFTAFHYYIGGDKVAVEIKIDD
GSWITLSDLNKTTSSSTSAEQYHLDLSSYVVNATSFQLRWRYYDAYYAWYTAVDNIRIGS
STCDPISGNKVTAYVNDANFATTLNNAQLMVDGQPITVSVATEEDEQLSDGLLMSFIPDS
ATDIKLTAPLYESKDVVVSDFSLSSPIELNAGLLEVSTDAQTDFNITVGRDEERTLAVEN
TGTAGATYQVLMIPGSSEPLHVGVYDASGRHFGPKNLQDMDAKKSRYAADIKATQLPGGD
IIGNFDLGLLYGWGLVMDRNTGNLWVSDIDADPQLLTEYQTDGIQTGRTILTPKEQGWGA
DLTFNGRTNSYWQVYVGGDNCIVEISEQGGLTGEKICPEFAQSQRGLAYDPMTDTYYSGS
WNDSLIHQFNTNGELLRSINVNMAIAGLAFNSANGQLYVTHNAAAATGVFDIYVLDVNTD
YLDIVGGFNVEDQNGTSLRGQAGLEIDCDGNLWTVDQTQQKVLGIATQSGGVCDWKIVPG
LTLKEDHEGAIEAGESNDIQLTLKASELAVGEYEATIIVMNDTPYGVTNIPLSIVVTEAV
VGELGFKETAASVKNGDAVELLIARTNGDDFAASVKYELVSNSAIAGEHFDAANGLVEWA
DKDATDKSVLIETINLDLDQDISFTVRLSDASGATLNEAAKDTSLITITADKLGVIAVKE
TNVSVNEEDGSAEITLSRTDGSDREVMVNYAVSHISTNDTDLADTTGTVAWADGDIEDKT
ISITINDDANVEADEAFNLVISATDSTIELGATVTAVRVLNTDKVEVKAKESSGGSLGFL
SLVILSLFGLSRRKFMG
Download sequence
Identical sequences B8CH14
WP_020910391.1.101980 gi|212633069|ref|YP_002309594.1| 225849.swp_0164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]