SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 225849.swp_0352 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  225849.swp_0352
Domain Number 1 Region: 7-139
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.67e-26
Family Glycosyl hydrolases family 16 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 225849.swp_0352
Sequence length 158
Comment (Shewanella piezotolerans WP3)
Sequence
MKPAARAGVVSSFFLFASPYDIAPNGNGLHHEIDIEFLGDNTNFMQINFWRNGEPAAGEN
ALLIPLQFDAALDFHRYGIRWSSGKIQWYVDGLLVHQVDSNNSPHIPTTNESNLMTMMNM
WATHEDISVWAGEFDPALGAAQSYYKDFSYQTLKQCQF
Download sequence
Identical sequences B8CHR0
225849.swp_0352 gi|212633248|ref|YP_002309773.1| WP_020910568.1.101980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]