SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 225849.swp_1666 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  225849.swp_1666
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.03e-23
Family Dual specificity phosphatase-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 225849.swp_1666
Sequence length 156
Comment (Shewanella piezotolerans WP3)
Sequence
MQHLFWLVEGQIAGRSGPNKDAWDLSELKGEGIDAILSVNNGESCEDEDFSSVGIEYKCI
PFSRNAPPEAGDLEYCVEQVPKALAYIRQCEAQNKTVLIHCRSGKDRTGLIMAYYLMDNG
AAPLHAVSQIRAIRDIAFSADGWDQFAFDVLYALQE
Download sequence
Identical sequences B8CLB5
WP_020911819.1.101980 225849.swp_1666 gi|212634503|ref|YP_002311028.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]