SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 225849.swp_1909 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  225849.swp_1909
Domain Number - Region: 145-216
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0589
Family Fibrinogen coiled-coil and central regions 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 225849.swp_1909
Sequence length 221
Comment (Shewanella piezotolerans WP3)
Sequence
MNKHNILFIGLDTHKEFVEIAYIEDQRGAQAVHFGRVSSAKASITRLARQFQSKYPEATL
HFVYEAGPCGYWIYRLLTSLGHCCYVIAPSLIPKKPGEKIKTDKRDALKLARLLKSEDLT
AIYVPEPEDEAIRDLSRARETAMKDLKDAKYQLKALQLRNNINYRGTANWSLKHLRWLTE
LILPHPSQQIVLQEYLQTISERIARLKRLDNELEHHVKKWR
Download sequence
Identical sequences B8CLL7
gi|212634730|ref|YP_002311255.1| 225849.swp_1909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]