SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 225849.swp_3663 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  225849.swp_3663
Domain Number 1 Region: 6-74
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 4.44e-18
Family Short-chain ferredoxins 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 225849.swp_3663
Sequence length 84
Comment (Shewanella piezotolerans WP3)
Sequence
MALLIDDSCINCDMCEPECPNEAITMGEEIYEIEPLLCTECKGHYDKPTCISVCPIDCIA
VDPDNKESDEELLVKYQIITGKTI
Download sequence
Identical sequences B8CS60
gi|212636412|ref|YP_002312937.1| WP_020913695.1.101980 225849.swp_3663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]