SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 225849.swp_4584 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  225849.swp_4584
Domain Number 1 Region: 3500-3702
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.6e-26
Family Clostridium neurotoxins, the second last domain 0.059
Further Details:      
 
Domain Number 2 Region: 2723-2895
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000305
Family Pentraxin (pentaxin) 0.036
Further Details:      
 
Weak hits

Sequence:  225849.swp_4584
Domain Number - Region: 3722-3790
Classification Level Classification E-value
Superfamily E set domains 0.00819
Family Filamin repeat (rod domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 225849.swp_4584
Sequence length 4881
Comment (Shewanella piezotolerans WP3)
Sequence
MDNGQNQFQAESLQGQFGTLTINNLGHWTYTADNAQGVIQGLKTGESLTDTLVVHSVDGS
EQKVTVTINGTDDKAVIAGTSTASLTEDKKVHSGILRVDGVLTITDVDNGQNQFQAESLQ
GQFGTLSINNLGHWTYTADNSQAVIQGLKTSESLTDTLLVHSIDGSEQKITVTINGTDDK
AVIAGSSTASLTEDKDVHQGLLRADGNLSITDPDNGQAQFTAESLQGQFGTLSINNLGHW
IYTADNSQAVIQGLKTSESLTDTLLVHSVDGTEQKITVTINGTDDKAVIAGSSSASLTED
KEVHSGLLRVDGALTITDVDNGQNQFQTESLQGQFGTLSINNLGHWIYTADNSQAVIQGL
KTGESLTDTLLVHSVDGTEQKITITINGTDDKAVVSGTSTATLTEDKDVHGGQLRVDGAL
SVIDADNGQNQFQAESLQGQFGTLSINNLGHWTYTADNSQAVIQGLKTSESLTDTLLVHS
VDGTEQKITVTINGTDDKAVIAGSSSASLTEDKEVHSGLLRVDGALTITDVDNGQNQFQA
ESLQGQFGTLSINNLGHWIYTADNSQTAIQGLKTSESLTDTLLVHSIDGTEQKITVTING
TDDKAVIAGSSTASLTEDKDVHSGQLRVDGALSVTDPDNGQNQFQAESLQGQFGTLSINN
LGHWIYTADNSQTAIQGLKTSESLTDTLVVHSVDGTEQKITVTINGTDDKAVIGGTSTAN
LTEDKDVHQGLLRADGNLSITDPDNGQAQFTAESLQGQFGTLSINNLGHWIYTADNSQAV
IQGLKTGESLTDTLLVHSVDGTEQKVSVTINGTDDKAVIGGTSTASLTEDKDVHQGLLRA
DGNLSITDPDNGQAQFTAESLQGQFGTLSINNLGHWIYTADNSQAVIQGLKTGESLTDTL
LVHSVDGTEQKITVTINGTDDKAVIGGTSTTSLTEDKDVHQGLLRADGNLSITDPDASQQ
QFQAESLQGQFGTLSINNLGHWIYTADNSQTVIQGLKTGESLTDTLLVHSLDGTEQKITV
TINGTDDKAVISDTSIASLTEDKDVHAGQLRVDGTLSVTDADNGQAQFTAESLQSQFGTL
SINNLGHWIYTADNSQAVIQGLKTGESLTDTLVVHSVDGTEQKITVTIDGTDDKAVIGGT
STANLTEDKDVHSGQLRADGNLNITDPDNGQAQFTAESLQGQFGTLSINNLGHWIYTADN
SQAVIQGLKTGESLTDTLLVHSVDGTEQKIIVTINGTDDKAIIGGVDTGSVTENAAGVDM
SPDHAQPGMATLGQSSLSTSGQLTIIDPDSGQAHFDPNGKVYSYHGQYGHLLLHPDGHWD
YAVAAGSHDWHLGSTKTTVGSQIDQLGEGQTLTDTITVHSLDGTTHDIKITIHGSNDKPY
CAAEVTLQPGTEDTSQTFTLAQLLANTTDVDTNDAGKLTIANISVNHGSLKDNQDGTFTF
TPEKDYNGQVHFSYDVKDDHGGLTHTGATTTLSAVGDTAIISEVTTGTVIEDGSHSSQNL
GHITELASGSLQVIDPDSGENRFRYSQFGETAIKDQFNGQLRIDSAGNWGYSVDNSQLQH
LAAGQTEEVVYRVHSQDGTAYELHIQVEGTNDAPVANVVALTNGTEDTHYQMQASQFGFT
DIDTGDTLHAIAITDLPPASQGKFVLDGQTITAGQSITTADISKLQFIPAKDFNGDVQFA
YTVNDGHVDSAKVSNILHISAIDDAAKIHGDTHGNVTEGDIGDQTTATGQLTITDVDAGQ
NPVFPDITSTATTYGHIEMNNGQWTYTLNQNKVQQLDPDQAPVVDHHTFTASDGSTQVVD
ITISGSNDKPIIESAHVAPAGTSATLKLQEVSIISQPTGANIDVAASNAENTARWGTDVT
GVATGVKLVGLYKPGSDHNWITTPATTTTDHSGVGGFSRVDNHDWWHQHGIPDTVNTGSG
GASGHGNVWSGGIVVFEDATGHQTIGIINRVCTGGGSEVDYLYYHAYQNLQLGSTAYSGT
AAPGETINVMDGNNKLASVVADSHGHWQVAANHLSDGLHTLHVENSTGQHSAETVFQVSG
NVVSNITPAGLNAELKEDAAQATIDGELRTSDIDSGDSASFNIQAQHTTKYGHFSLDADG
KYHYTIDNTNPTVNQLGVNQTLTEVIPVTSTSTDGSTVTNNITITIHGSVDKPTLSASAP
DAQQGTVMDLNLNVAATDTGGDTENLLIKISGLPDHALLNHGTYDNIAKMWVLHKADLTG
LTLDLKAPHFHGDLQFNVTATASAGGESQSITQAVTMFINEPPSVSAAVTGSKIEDSGMG
AINLLQGATDADTAEVLSVADLQYQVGTTSQSTTKPDFLSIGKDGHTLVVNANAAEFQHL
AAGETEVITVSYNVKDSHGGQVAQTAKITITGKDDAAQISGHISTDERTHITEDLRLSGT
HMLSSDRMTLQVTDTDSSENYFIPTGASGNTDAHSHGSWVNGDQHVGEFILHASGEWLFR
ADNNNSKINSLGEGEKITDTITVHSADGTAQQLTAVIYGSNDRPTITTQVISATEDTDYQ
FTLANFGFTDVDSHDSLDHITITSLPDVAQGSLLINGVAVSANQQISAADISHLTFKPAL
NFNGDVHFGYTVSDGHADSSAARASIHVAAVNDPLTDSGARDLGATDEDRSIHITQAQLL
EHLSDVDGNLSVIGLPTSPHGSFSSDAAHGFTFTPATNFHGDNLDIQYQVTDGTSQSSAH
ASIDVTSVTDPATVSLHISAEQQVMSFGSGDKTAYAKVDGIDAGGPMHAMSAEITFVLDN
GHPPSNAAVLLNYSVPGGHDQQNTITFWNASNLQFAFMGPTVDTGVNLLDGNTHRLTMTW
DSGSGHLVVFDNGHIIKQQTVNQGGTFPNGGTFIAGTRDNSAGADNPTDYTASLSAGGRV
FSATMVDHAVTPASVALGTIAHEPNGVLTNIMADGKGNFIDTTGHHTVTSGSGAHTVVVP
VDSNAGTIPRGALLHLHPNAAVNAPDDVVTKLEISGLIKGTLLSDGHGHQHTIASLNDKV
DIHGWNTASLTAQLPHDAATNMNVALTATTQAPDGKEAISIEHEGLQLDPNKPIPDATIT
GDSTGNTDEDHSVSGQLTVTDTDASQAHFAANDVSGTYGHLSIDSAGQWTFTPNATANAL
TKNDQVHETYTVTSIDGTQHQITINIDGRDDNPIVTELAAPKTVIEDGGHDHVRTSGMLS
ISDPDTGDTHSITEQTDVLGTYGHFSIAANGGWHYELDNALATTQGLTEGQHVTETFNVI
VTDSEGGQTTHTMHFDVQGSNEAPTIAVQVINANEDTHYQFTASNFGFTDVDGGSLTSVT
VTELPDPSLGMLYLHGVAVSANQVISTADISALIFAPELNINGKVNFKYSVTDGHDSSSV
ATGVIDIAAKNDAPTSVHLSIRDVEDHSHTFSKSEFGFADVDSGDTLQHITITHLPNPAH
GALLLDGQAVVAGQQIDTDDIAKLVFTPVKDFNGESAFKYSVSDGSLDSKQYTGAIHISA
DNDAPTFLAGGQFASLPISAAYEFSAGQGTDLSGRNNHAVLSGAVTATTGADGTPDSAVQ
FHGDSSAKIEVPDLQYGQGITVSATVRFDSIADSYSRVFDFGNGQAKDNILLTHSGTTDT
LQLEFIDAAGQKHDLMVPHGVTPGQWMKLTATISHDGHMALYNNGQLLGETDSGAQLPAI
ARSENYIGKSHWAQDGNLHGAFDNFAVFDQVISPAQIKALASANSLNDLLHKYDQIDHDQ
FHATVNVNQSFTINQNDILNQATDIDGDTLSVSHVSIAGNHGTIHDNGDGTWTVTPNLNY
RGELKIEVDVTDGQETLPAHLTVQVGNASITGDSKLTTDETHADTGQLTVTDPDSNQDHF
IAQVLPSSHGEFTIDTSGSWQYTPNKAAQALSQGQSATDIVTVKTADGTEHQISVSLSGS
DTAPTSVTTDLGKVESGSTYDFQAADLLTNVTDVDTSSTGLSIVAGSFHSPHGKVSTNPD
GSFTFTANPGFTGNDLAISFQVSDGHNTIDANAIIDVTPPLAITRLGYDTGISDSDFVTS
DGHIILYGTGEPGSSIIGSGILSSAKTIVDANGHWKLDASATDVADGTYTMTVFEAKADG
SYAQAHHRVTIDTAKPTVSINPISKDDWVDHDEHQQDLTISGTCTHVSDGDPVQVTLAGQ
HYQAVVHDNHWQVIVPASATASIADNAYHIRAEVVATATSDSASTQRNLVVSADLSTLVQ
TPHVEEDTKTAATGHLFALGSSNTVASLGVLHGNYGTLHINADGSYQYTLDNQHTDIQQM
SATEQHADNFFISYTNPHGDSKHAVLNIGIHGTNDAPVLTGTFEISRSVTTGSMTHTHSY
GYINIADLDKNDTVTVECVDAQGVTHLLDMHAHSSNKIEVKGIGHFNIDPDGKWDFTFSH
SGPERDKLNQEVAAGHIHTESVTLKITDSTGVSRQETLTVHIGDGKTGPQIFGASESVVT
EDKVTQSHGLLDLLVGDVKVESGVTWEIKPGNQPQYGDLTLSPDGSWQYRAHNNTAQVQG
LAEGERLEETIMVTATDTQGHSVDQAMKLVIIGTNDVPVIAHPLASNTVEEHLLTLTKAD
LLANVQDTDNTDTLNVSHLQLVGGGSINQQGDHWVINPGINFSGELRLNYQVSDGHVAVD
NAMTVHVAAEADTPTMIFTKHVGDLSSPLDSHLIQGNQNTDLALNINVSSPDASETLTVE
ITGIPSDTHLSAGHEHNGIWTLQQSELTNLKLIPEASFTGHFDIQVSAISHDGSSQATQS
QTLGVEVLPSLAAPSMTVAADEPNEPISDIDLASVYTDTIDSPVDHYFNMLGLSPSSQTS
SEISQTPEPLTEMATLSQSGSDADMLDIHQSDGFENPLDDDQHHLPSDHLADNDPQIDQA
EHYANDDDLLHQALNDMHNQL
Download sequence
Identical sequences B8CUN2
gi|212637286|ref|YP_002313811.1| 225849.swp_4584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]