SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 226185.EF3170 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  226185.EF3170
Domain Number 1 Region: 314-465
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 6.06e-31
Family HD domain 0.015
Further Details:      
 
Domain Number 2 Region: 207-302
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.62e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Weak hits

Sequence:  226185.EF3170
Domain Number - Region: 29-83
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.000615
Family F1F0 ATP synthase subunit B, membrane domain 0.0029
Further Details:      
 
Domain Number - Region: 121-162
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.0345
Family Hypothetical protein AF1548, C-terminal domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 226185.EF3170
Sequence length 518
Comment (Enterococcus faecalis V583)
Sequence
MVLNILLAIVGLIVGLGLGFVIAKSRHDKAINGAKISASSILENARKESETLKKEALLEA
KEENQKYRSEIESELKESRLELKSQENRLIQREQTLDRKDDSLEKREGSLEEKEEKLGAR
QQLIDEREKEVENLINQQHQELERIASLSKEEAKSIIMKSTEEELNHELTLMVKESEQRA
KEESDRKAKNLLSLAIQRCAADSVSETTVSVVTLPNDEMKGRIIGREGRNIRTLETLTGI
DLIIDDTPEAVVLSGFDPIRREIARMTLEKLIQDGRIHPARIEEMVEKSRKEMDERIREY
GEQAAFEVGAHTLHPDLIKILGRLRFRTSYGQNVLNHSIEVAKLAGVLAAELGEDVQLAK
RAGLLHDIGKALDHEIEGSHVEIGAELAAKYKENSVVINAIASHHGDVEATSVISVLVAA
ADALSAARPGARSESLENYIRRLENLENISNSFEGVDSSFAVQAGREVRVMVKPEEISDL
ESVRLVRDIRKKIEDDLDYPGHIKVTVIRETRAVDYAK
Download sequence
Identical sequences A0A059N2F9 A0A0H1U557 A0A0M2A7J7 A0A0M2AP39 A0A0U1AW02 A0A0Y4FIP8 A0A0Y7JI82 A0A125W2Y0 A0A1B4XS48 A0A1R4JUK9 C0X125 C7CYX1 C7VFH3 C7WXN9 D4EQV3 D4EZW0 E0HFW8 E2YEG4 E2YKI1 E2Z0P3 E6F0U2 E6GND8 E6GVC0 E6H8K0 E6ID88 J5C2B9 J5H3R2 J6AI64 J6D9W8 J6DFS3 J6DHD6 J6LTH6 J6M450 J6NDH3 J6PAV4 J6PHP6 J6QCS4 J6QTI0 J6QVZ5 J6R3W1 J6RC35 Q82Z99 R3GQS0 R3HUW4 S4F6Y7 S4FUH2 U6RXR2 V7ZPU6 X5NV35
gi|29377620|ref|NP_816774.1| gi|384514402|ref|YP_005709495.1| EfR123 NYSGXRC-6278f 226185.EF3170 NP_816774.1.90627 WP_002354863.1.100343 WP_002354863.1.100390 WP_002354863.1.100415 WP_002354863.1.10042 WP_002354863.1.100482 WP_002354863.1.101272 WP_002354863.1.101275 WP_002354863.1.101479 WP_002354863.1.101808 WP_002354863.1.101818 WP_002354863.1.101914 WP_002354863.1.10330 WP_002354863.1.10696 WP_002354863.1.10758 WP_002354863.1.11048 WP_002354863.1.11193 WP_002354863.1.11284 WP_002354863.1.11459 WP_002354863.1.11651 WP_002354863.1.11776 WP_002354863.1.12145 WP_002354863.1.12247 WP_002354863.1.12449 WP_002354863.1.12625 WP_002354863.1.12630 WP_002354863.1.12825 WP_002354863.1.12889 WP_002354863.1.1291 WP_002354863.1.12926 WP_002354863.1.13365 WP_002354863.1.13369 WP_002354863.1.1344 WP_002354863.1.13739 WP_002354863.1.14157 WP_002354863.1.14180 WP_002354863.1.14269 WP_002354863.1.14402 WP_002354863.1.14420 WP_002354863.1.14485 WP_002354863.1.14750 WP_002354863.1.14792 WP_002354863.1.15224 WP_002354863.1.15286 WP_002354863.1.15458 WP_002354863.1.15543 WP_002354863.1.15705 WP_002354863.1.1595 WP_002354863.1.16241 WP_002354863.1.16763 WP_002354863.1.17164 WP_002354863.1.17287 WP_002354863.1.17682 WP_002354863.1.17799 WP_002354863.1.17800 WP_002354863.1.1799 WP_002354863.1.18048 WP_002354863.1.18259 WP_002354863.1.18260 WP_002354863.1.18390 WP_002354863.1.18416 WP_002354863.1.18475 WP_002354863.1.18524 WP_002354863.1.18709 WP_002354863.1.19031 WP_002354863.1.19115 WP_002354863.1.19165 WP_002354863.1.1948 WP_002354863.1.19601 WP_002354863.1.19675 WP_002354863.1.19734 WP_002354863.1.19902 WP_002354863.1.19951 WP_002354863.1.20029 WP_002354863.1.20348 WP_002354863.1.20659 WP_002354863.1.2067 WP_002354863.1.20674 WP_002354863.1.2171 WP_002354863.1.21993 WP_002354863.1.22059 WP_002354863.1.2207 WP_002354863.1.22780 WP_002354863.1.22796 WP_002354863.1.23017 WP_002354863.1.23054 WP_002354863.1.23319 WP_002354863.1.23322 WP_002354863.1.23498 WP_002354863.1.23569 WP_002354863.1.23904 WP_002354863.1.24023 WP_002354863.1.24059 WP_002354863.1.24064 WP_002354863.1.24526 WP_002354863.1.24581 WP_002354863.1.246 WP_002354863.1.24743 WP_002354863.1.2486 WP_002354863.1.25180 WP_002354863.1.25583 WP_002354863.1.25669 WP_002354863.1.25702 WP_002354863.1.25704 WP_002354863.1.25979 WP_002354863.1.26187 WP_002354863.1.26451 WP_002354863.1.27081 WP_002354863.1.27216 WP_002354863.1.274 WP_002354863.1.2799 WP_002354863.1.2801 WP_002354863.1.28038 WP_002354863.1.28185 WP_002354863.1.28221 WP_002354863.1.28428 WP_002354863.1.28487 WP_002354863.1.28579 WP_002354863.1.28817 WP_002354863.1.28932 WP_002354863.1.28980 WP_002354863.1.29097 WP_002354863.1.29627 WP_002354863.1.29985 WP_002354863.1.3016 WP_002354863.1.30275 WP_002354863.1.30586 WP_002354863.1.30609 WP_002354863.1.31224 WP_002354863.1.31324 WP_002354863.1.31326 WP_002354863.1.31656 WP_002354863.1.31869 WP_002354863.1.32099 WP_002354863.1.321 WP_002354863.1.32265 WP_002354863.1.32385 WP_002354863.1.32500 WP_002354863.1.32914 WP_002354863.1.33139 WP_002354863.1.33306 WP_002354863.1.33460 WP_002354863.1.33513 WP_002354863.1.33531 WP_002354863.1.33574 WP_002354863.1.33581 WP_002354863.1.33685 WP_002354863.1.33798 WP_002354863.1.33851 WP_002354863.1.34192 WP_002354863.1.34256 WP_002354863.1.34766 WP_002354863.1.34947 WP_002354863.1.34999 WP_002354863.1.35171 WP_002354863.1.35283 WP_002354863.1.35810 WP_002354863.1.35823 WP_002354863.1.36198 WP_002354863.1.36209 WP_002354863.1.36269 WP_002354863.1.3645 WP_002354863.1.36880 WP_002354863.1.36900 WP_002354863.1.37031 WP_002354863.1.37181 WP_002354863.1.37810 WP_002354863.1.37850 WP_002354863.1.37885 WP_002354863.1.37996 WP_002354863.1.38725 WP_002354863.1.38784 WP_002354863.1.3909 WP_002354863.1.39119 WP_002354863.1.39771 WP_002354863.1.39932 WP_002354863.1.4014 WP_002354863.1.4071 WP_002354863.1.40757 WP_002354863.1.40908 WP_002354863.1.41053 WP_002354863.1.41867 WP_002354863.1.42239 WP_002354863.1.42353 WP_002354863.1.42483 WP_002354863.1.42904 WP_002354863.1.42908 WP_002354863.1.43540 WP_002354863.1.43903 WP_002354863.1.43994 WP_002354863.1.44185 WP_002354863.1.44242 WP_002354863.1.44501 WP_002354863.1.44537 WP_002354863.1.44626 WP_002354863.1.4487 WP_002354863.1.45269 WP_002354863.1.45484 WP_002354863.1.455 WP_002354863.1.4561 WP_002354863.1.45643 WP_002354863.1.45742 WP_002354863.1.45860 WP_002354863.1.45925 WP_002354863.1.46056 WP_002354863.1.46113 WP_002354863.1.46346 WP_002354863.1.46348 WP_002354863.1.46357 WP_002354863.1.46363 WP_002354863.1.46448 WP_002354863.1.46606 WP_002354863.1.46621 WP_002354863.1.47172 WP_002354863.1.47217 WP_002354863.1.47225 WP_002354863.1.47407 WP_002354863.1.47539 WP_002354863.1.47856 WP_002354863.1.47867 WP_002354863.1.48063 WP_002354863.1.48126 WP_002354863.1.48153 WP_002354863.1.48676 WP_002354863.1.49131 WP_002354863.1.49392 WP_002354863.1.49646 WP_002354863.1.4975 WP_002354863.1.49914 WP_002354863.1.49961 WP_002354863.1.50067 WP_002354863.1.50115 WP_002354863.1.50160 WP_002354863.1.50513 WP_002354863.1.50810 WP_002354863.1.5083 WP_002354863.1.50938 WP_002354863.1.51046 WP_002354863.1.5113 WP_002354863.1.51694 WP_002354863.1.52575 WP_002354863.1.52614 WP_002354863.1.52926 WP_002354863.1.53279 WP_002354863.1.53342 WP_002354863.1.53631 WP_002354863.1.53989 WP_002354863.1.53992 WP_002354863.1.54277 WP_002354863.1.54634 WP_002354863.1.54652 WP_002354863.1.54795 WP_002354863.1.54934 WP_002354863.1.54998 WP_002354863.1.55065 WP_002354863.1.56483 WP_002354863.1.5680 WP_002354863.1.56974 WP_002354863.1.57048 WP_002354863.1.57136 WP_002354863.1.57163 WP_002354863.1.57211 WP_002354863.1.57242 WP_002354863.1.57302 WP_002354863.1.57542 WP_002354863.1.57671 WP_002354863.1.57705 WP_002354863.1.57758 WP_002354863.1.57968 WP_002354863.1.58089 WP_002354863.1.58620 WP_002354863.1.5872 WP_002354863.1.58766 WP_002354863.1.59454 WP_002354863.1.59564 WP_002354863.1.59645 WP_002354863.1.59658 WP_002354863.1.59690 WP_002354863.1.59698 WP_002354863.1.5994 WP_002354863.1.59964 WP_002354863.1.60200 WP_002354863.1.60220 WP_002354863.1.60361 WP_002354863.1.60394 WP_002354863.1.60422 WP_002354863.1.60579 WP_002354863.1.60776 WP_002354863.1.60940 WP_002354863.1.61083 WP_002354863.1.61089 WP_002354863.1.61103 WP_002354863.1.61180 WP_002354863.1.61290 WP_002354863.1.61503 WP_002354863.1.6167 WP_002354863.1.61932 WP_002354863.1.62847 WP_002354863.1.62949 WP_002354863.1.6312 WP_002354863.1.63148 WP_002354863.1.63477 WP_002354863.1.63507 WP_002354863.1.63579 WP_002354863.1.63848 WP_002354863.1.63884 WP_002354863.1.64022 WP_002354863.1.64483 WP_002354863.1.6473 WP_002354863.1.65210 WP_002354863.1.65397 WP_002354863.1.65461 WP_002354863.1.65563 WP_002354863.1.6626 WP_002354863.1.66308 WP_002354863.1.66316 WP_002354863.1.66390 WP_002354863.1.66403 WP_002354863.1.66767 WP_002354863.1.6682 WP_002354863.1.66843 WP_002354863.1.66845 WP_002354863.1.66898 WP_002354863.1.66902 WP_002354863.1.67436 WP_002354863.1.67615 WP_002354863.1.67683 WP_002354863.1.67716 WP_002354863.1.68409 WP_002354863.1.68746 WP_002354863.1.68828 WP_002354863.1.6893 WP_002354863.1.68935 WP_002354863.1.69290 WP_002354863.1.69336 WP_002354863.1.69521 WP_002354863.1.69648 WP_002354863.1.69824 WP_002354863.1.70043 WP_002354863.1.70675 WP_002354863.1.70756 WP_002354863.1.70799 WP_002354863.1.71303 WP_002354863.1.71406 WP_002354863.1.71499 WP_002354863.1.71510 WP_002354863.1.71725 WP_002354863.1.72058 WP_002354863.1.72077 WP_002354863.1.72635 WP_002354863.1.72733 WP_002354863.1.73695 WP_002354863.1.73824 WP_002354863.1.74362 WP_002354863.1.74389 WP_002354863.1.74591 WP_002354863.1.75211 WP_002354863.1.75297 WP_002354863.1.75486 WP_002354863.1.75949 WP_002354863.1.76074 WP_002354863.1.76128 WP_002354863.1.76541 WP_002354863.1.76646 WP_002354863.1.76958 WP_002354863.1.77302 WP_002354863.1.77327 WP_002354863.1.77328 WP_002354863.1.77357 WP_002354863.1.77956 WP_002354863.1.7815 WP_002354863.1.7819 WP_002354863.1.78447 WP_002354863.1.78471 WP_002354863.1.78503 WP_002354863.1.78587 WP_002354863.1.78641 WP_002354863.1.79457 WP_002354863.1.7958 WP_002354863.1.79791 WP_002354863.1.79975 WP_002354863.1.80104 WP_002354863.1.80396 WP_002354863.1.80452 WP_002354863.1.80556 WP_002354863.1.8058 WP_002354863.1.80867 WP_002354863.1.80889 WP_002354863.1.80976 WP_002354863.1.81312 WP_002354863.1.81327 WP_002354863.1.81459 WP_002354863.1.81575 WP_002354863.1.8179 WP_002354863.1.81880 WP_002354863.1.81991 WP_002354863.1.82160 WP_002354863.1.82202 WP_002354863.1.82555 WP_002354863.1.82993 WP_002354863.1.83032 WP_002354863.1.83327 WP_002354863.1.83490 WP_002354863.1.83649 WP_002354863.1.8380 WP_002354863.1.83953 WP_002354863.1.84260 WP_002354863.1.84380 WP_002354863.1.84469 WP_002354863.1.84573 WP_002354863.1.84632 WP_002354863.1.84813 WP_002354863.1.85162 WP_002354863.1.85355 WP_002354863.1.85465 WP_002354863.1.85534 WP_002354863.1.8575 WP_002354863.1.85848 WP_002354863.1.85862 WP_002354863.1.85945 WP_002354863.1.85963 WP_002354863.1.86134 WP_002354863.1.86666 WP_002354863.1.86904 WP_002354863.1.87000 WP_002354863.1.87252 WP_002354863.1.87277 WP_002354863.1.87385 WP_002354863.1.87482 WP_002354863.1.87855 WP_002354863.1.8794 WP_002354863.1.88329 WP_002354863.1.88464 WP_002354863.1.88661 WP_002354863.1.8901 WP_002354863.1.89060 WP_002354863.1.89088 WP_002354863.1.89321 WP_002354863.1.89431 WP_002354863.1.8960 WP_002354863.1.89791 WP_002354863.1.90047 WP_002354863.1.90100 WP_002354863.1.90371 WP_002354863.1.90503 WP_002354863.1.90642 WP_002354863.1.90872 WP_002354863.1.91092 WP_002354863.1.91394 WP_002354863.1.91555 WP_002354863.1.9159 WP_002354863.1.91608 WP_002354863.1.91813 WP_002354863.1.91925 WP_002354863.1.92037 WP_002354863.1.92073 WP_002354863.1.9214 WP_002354863.1.92348 WP_002354863.1.92581 WP_002354863.1.92820 WP_002354863.1.93159 WP_002354863.1.93277 WP_002354863.1.93642 WP_002354863.1.93977 WP_002354863.1.94041 WP_002354863.1.94399 WP_002354863.1.94506 WP_002354863.1.94612 WP_002354863.1.94630 WP_002354863.1.94964 WP_002354863.1.95143 WP_002354863.1.95212 WP_002354863.1.95228 WP_002354863.1.95340 WP_002354863.1.95445 WP_002354863.1.95493 WP_002354863.1.95534 WP_002354863.1.95629 WP_002354863.1.9570 WP_002354863.1.95935 WP_002354863.1.95970 WP_002354863.1.95971 WP_002354863.1.96320 WP_002354863.1.96467 WP_002354863.1.96481 WP_002354863.1.96745 WP_002354863.1.96764 WP_002354863.1.96987 WP_002354863.1.97078 WP_002354863.1.97268 WP_002354863.1.97643 WP_002354863.1.97828 WP_002354863.1.98078 WP_002354863.1.98122 WP_002354863.1.9842 WP_002354863.1.98652 WP_002354863.1.98840 WP_002354863.1.98868 WP_002354863.1.99 WP_002354863.1.99014 WP_002354863.1.99022 WP_002354863.1.9925 WP_002354863.1.99432 WP_002354863.1.99543 WP_002354863.1.99748 gi|384516966|ref|YP_005704271.1| gi|397701311|ref|YP_006539099.1| gi|479181658|ref|YP_007808967.1| gi|428768275|ref|YP_007154386.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]