SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 226186.BT_0151 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  226186.BT_0151
Domain Number 1 Region: 4-77
Classification Level Classification E-value
Superfamily GlnB-like 7.56e-17
Family RPA1041-like 0.029
Further Details:      
 
Weak hits

Sequence:  226186.BT_0151
Domain Number - Region: 114-126
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0307
Family Cytochrome c3-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 226186.BT_0151
Sequence length 144
Comment (Bacteroides thetaiotaomicron VPI-5482)
Sequence
MKTVKLITCNDAMKAHILQGALENEGIESILHNENFSTLYKSCVSSIAGVDILVADEDYE
KAVQVLRQNQSWPEELTLCPYCGSSDIKFVLRKGHKLRAVGAAVLSMLAAAPPGDNHWEY
TCQQCHQTFETPVAEFQPSGEDEE
Download sequence
Identical sequences A0A0P0FG30 A0A1H7Y0D5 D7IAE7 Q8ABF9 R7KX71 R9HF35
226186.BT_0151 396682 NP_809064.1.73244 WP_008760469.1.19130 WP_008760469.1.24025 WP_008760469.1.29471 WP_008760469.1.52087 WP_008760469.1.54521 WP_008760469.1.59332 WP_008760469.1.59346 WP_008760469.1.67099 WP_008760469.1.81417 WP_008760469.1.83447 WP_008760469.1.97929 gi|29345561|ref|NP_809064.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]