SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 226186.BT_0819 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  226186.BT_0819
Domain Number - Region: 3-57
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0334
Family Calponin-homology domain, CH-domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 226186.BT_0819
Sequence length 82
Comment (Bacteroides thetaiotaomicron VPI-5482)
Sequence
MAQHTYDEESVQELLGWAKKMLETKNYPTEKYQVNACTSIIDGKLYLESLISMISKNWEN
PTFHPTIEQLWEYREKWEGQKE
Download sequence
Identical sequences A0A139KT45 Q8A9J6
gi|29346229|ref|NP_809732.1| 226186.BT_0819 NP_809732.1.73244 WP_011107467.1.24025 WP_011107467.1.29471 WP_011107467.1.59346 APC81395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]