SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 226186.BT_1283 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  226186.BT_1283
Domain Number 1 Region: 197-397
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.54e-22
Family Clostridium neurotoxins, the second last domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 226186.BT_1283
Sequence length 440
Comment (Bacteroides thetaiotaomicron VPI-5482)
Sequence
MKKQKIRFAIFMLLLAVTACDNADYSKSAPFDNGVYLSVAESKTSETMTFNKTIIQREKS
FTARLAYPAGTDVTVNVTVDPSQVEAYNSRNNTSYDILPAKHYRLESNEMTIRAGKINSA
PLHIYFENLTELEIDKAYLCPVSLNSAQGVGLLDGSTTYWYIVKRSSAITTAVDLRYCYV
EVPGFYVPKWGTEPAGNAAHLNNLKAVTFEIITRISNFDEANTDISSLMGIEQYFCFRAG
DAGFPRQQLQIQTPAGKFPEANKAKLLKENEWYHLALTYDIATKTIIFYVNGKEQSRSTN
YGNSEFSEIKLANRKQESFPGASDGDWLFYIGRSYNDRWLIDRQLNGNVCEARIWDVART
QQEIWKNMYDIEDPENEAHLAAYWKFNEGSSNDIKDYSKYHNDAHIVRYWKDFNSKEEYD
VKNEELWPSGIEVPQVNRED
Download sequence
Identical sequences A0A2J6A9R1 Q8A891
NP_810196.1.73244 WP_011107688.1.24025 226186.BT_1283 gi|29346693|ref|NP_810196.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]