SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 226186.BT_1588 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  226186.BT_1588
Domain Number 1 Region: 4-149
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 6.21e-24
Family TM1012-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 226186.BT_1588
Sequence length 156
Comment (Bacteroides thetaiotaomicron VPI-5482)
Sequence
MKIKDKITQSLASITVELQEISPDFYVIGASAMILSGIEVGETADIDILTTEMNSCKLQH
LLKTYMEISPETKEDDLFRSNFARFKLPLMDIEVMGDLQIKKNDIWQSVCVKEYEEIFIG
NLIIKIPTIEEQKRILSLFGREKDLKRILILNHYLL
Download sequence
Identical sequences A0A0P0EY74 D7IFK5 Q8A7D6
226186.BT_1588 NP_810501.1.73244 WP_008762139.1.24025 WP_008762139.1.52087 WP_008762139.1.59346 WP_008762139.1.81417 WP_008762139.1.83447 WP_008762139.1.97929 358710 APC82325 gi|29346998|ref|NP_810501.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]