SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 226186.BT_2203 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  226186.BT_2203
Domain Number 1 Region: 52-258
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.28e-27
Family Clostridium neurotoxins, the second last domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 226186.BT_2203
Sequence length 317
Comment (Bacteroides thetaiotaomicron VPI-5482)
Sequence
MYTHLTDMTNMLDTAKIGTSDGTFPLANAQNLQKAVEELQTGISKGMAGYFVLQYEIDNY
CIAAEKAIAEFQDSYQQTLQPGTPAELKVFGIDGKGRIEFGSDPAYGGGNTFTVESWVKY
DAGFFESGIGSFLSTFDGKQPNEGWMINFLGSNLRTTIGMGPQEGRVLEEGRAYPDNFGK
WNHVVTVWDNTLPEGQLKMYVNGELFFSKTNDVKNDAGVLQNYMPNTRNQNMWAFQEPTD
NSRCMTGFIKKFRMWSTAKSANEVKTLMNSDVTGTESGLVCAWDFTTVVEDVTNIPDKTG
KHVAKIVGNYKWFKVEN
Download sequence
Identical sequences A0A139KVY9 Q8A5N5
226186.BT_2203 APC81706 gi|29347613|ref|NP_811116.1| NP_811116.1.73244 WP_011108169.1.29471 WP_011108169.1.59346 WP_011108169.1.81417 WP_011108169.1.83447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]