SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 226186.BT_2563 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  226186.BT_2563
Domain Number 1 Region: 297-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.35e-47
Family Ribonuclease PH domain 1-like 0.0000845
Further Details:      
 
Domain Number 2 Region: 12-145
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.01e-43
Family Ribonuclease PH domain 1-like 0.0001
Further Details:      
 
Domain Number 3 Region: 146-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.51e-28
Family Ribonuclease PH domain 2-like 0.00095
Further Details:      
 
Domain Number 4 Region: 452-552
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.54e-26
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 5 Region: 615-702
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.97e-19
Family Cold shock DNA-binding domain-like 0.001
Further Details:      
 
Domain Number 6 Region: 556-636
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.51e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 226186.BT_2563
Sequence length 708
Comment (Bacteroides thetaiotaomicron VPI-5482)
Sequence
MINPIVKTIELPDGRTITLETGKLAKQADGSVMLRMGNTMLLATVCAAKDAVPGTDFMPL
QVEYKEKFAAFGRFPGGFTKREGRASDYEILTCRLVDRALRPLFPDNYHAEVYVNIILFS
ADGVDMPDALAGLAASAALAVSDIPFNGPISEVRVARIDGQFVINPTFDQLEKADMDLMV
AATYDNIMMVEGEMHEVSEAELLEAMKVAHEAIKVHCKAQMELTEEVGKTVKREYNHEVN
DEELRKAVREACYDKAYAVAASGNNNKHERFDAFDAIREEFKAQFSEEELEEKAPLIDRY
YHDVEKEAMRRSILDEGKRLDGRKTTEIRPIWCEVGPLPGPHGSAIFTRGETQSLTSVTL
GTKLDEKIIDNVLEHGKERFLLHYNFPPFSTGEAKAQRGVGRREIGHGHLAWRALKGQIP
ADYPYVVRVVSEILESNGSSSMATVCAGTLALMDAGVKIKKPVSGIAMGLIKNPGEEKYA
VLSDILGDEDHLGDMDFKVTGTRDGITATQMDIKVDGLSYEILERALNQAKEGRMHILDK
ITETIAEPRADLKDHAPRIETMTIPKEFIGAVIGPGGKIIQGMQEETGAVITIEETDGMG
RIEVSGTNKKCIDDAMRMIKAIVAVPEVGEVYKGKVRSIMPYGAFIEFLPGKDGLLHISE
IDWKRLETVEEAGIKEGDEIEVKLIDIDPKTGKFKLSRKVLMPRPEKK
Download sequence
Identical sequences A0A0P0FJC2 A0A1H8P3K6 C6ITA8 Q8A4N6 R7KZV1 R9GZ26
gi|29347973|ref|NP_811476.1| NP_811476.1.73244 WP_008765197.1.19130 WP_008765197.1.24025 WP_008765197.1.28290 WP_008765197.1.29471 WP_008765197.1.52087 WP_008765197.1.54521 WP_008765197.1.58123 WP_008765197.1.59346 WP_008765197.1.67099 WP_008765197.1.81417 WP_008765197.1.83447 WP_008765197.1.97929 226186.BT_2563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]