SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 226186.BT_3523 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  226186.BT_3523
Domain Number 1 Region: 225-430
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.86e-16
Family Clostridium neurotoxins, the second last domain 0.02
Further Details:      
 
Weak hits

Sequence:  226186.BT_3523
Domain Number - Region: 86-159
Classification Level Classification E-value
Superfamily LemA-like 0.00706
Family LemA-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 226186.BT_3523
Sequence length 491
Comment (Bacteroides thetaiotaomicron VPI-5482)
Sequence
MKDMKQLINKWGESMLFSLLMALCLTWTFTACSDDKDNEYISDTQLSILEDNRTSLSYLL
KNSTFGTAPGTFPEASKEILNNAIAELDQLITKVKGGEMFDEATFEATIAKVNQAIDEFK
NSKYYNLSPEAQKFISDLMAKADELREMIANEALWGNHQGQYPVEGKATLESAAEDLESL
ADRIKTSAITDMTQEIYDDAIAAADKKLQEVENSAWPEDNLVWNLFVDGNKGGYIDFGYS
EDFVKFGDDNNQNFTIELWINIKEFCSKSGEDNSTFLAAFVNSPRSGWRVQYRKVNGGNE
HWLRGSMAHWQNEGPKDPEWWEPRAIVNNPKDKWTHFAFAVADNGVPGFDPPQEHTKSCV
FVNGSQSGEVIRVGEAWRTYINNGCIEEKMPMTAFCRLNTDKTTREEYFSGYIKYMRIWK
GIRSRDDLRLSAMGQVDVDPNDPNLVAAWDFEVLGAQPTGTTITDITGRHVATLKGPEGT
YQWVESTTIAQ
Download sequence
Identical sequences A0A0P0FK95 Q8A1Y5 R7KXN9
226186.BT_3523 NP_812435.1.73244 WP_011108860.1.29471 WP_011108860.1.59332 WP_011108860.1.81417 WP_011108860.1.83447 WP_011108860.1.97929 gi|29348932|ref|NP_812435.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]