SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 226186.BT_3754 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  226186.BT_3754
Domain Number 1 Region: 182-366
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.34e-22
Family Clostridium neurotoxins, the second last domain 0.046
Further Details:      
 
Weak hits

Sequence:  226186.BT_3754
Domain Number - Region: 43-129
Classification Level Classification E-value
Superfamily CalX-like 0.000602
Family CalX-beta domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 226186.BT_3754
Sequence length 396
Comment (Bacteroides thetaiotaomicron VPI-5482)
Sequence
MKMIKFSRYVVLGAALAVVTGCNDAKLSTIDNGVYIAEAAPSNTFSQQIEAQLVDEGDVI
KTLTVRLVRAIDQDVTVTLDIDQQLIDEYNQQHEASYELLPEEFRSFERTVTIPAGEVSA
PVINLTIKPFTTPNNEAYAIPVRITSVAGPIGLVGNANHILYLLTSPNKQKAVVLKSANK
TSLNFKNEIPVTQWTIEYWIKFDNTTGRPTGDWVGPANIAFRRLIFADNSAPISFNGVLL
RYWADGAKKIAPCLQCQLDGNYFDSEEFWYPDIWYHIAYTYDGSTISLYKDGTLNNSKAD
SRDFTFNNISLAQSFGWNMQVELAQIRLWSKCLTENAIQEGMSRQISGDSDGLIGYWKCD
EGKGNVLKDNSPNGNDITLTGIPAWSEQYNFYHPND
Download sequence
Identical sequences A0A0P0EWW6 A0A1H8I8V8 C6IPE3 D7IGW0 Q8A1B2 R7KJ26
NP_812665.1.73244 WP_008762691.1.19130 WP_008762691.1.24025 WP_008762691.1.28290 WP_008762691.1.52087 WP_008762691.1.54521 WP_008762691.1.59332 WP_008762691.1.83447 WP_008762691.1.97929 gi|29349162|ref|NP_812665.1| 226186.BT_3754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]