SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 226186.BT_3853 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  226186.BT_3853
Domain Number 1 Region: 229-465
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.96e-17
Family Galactose oxidase, central domain 0.023
Further Details:      
 
Weak hits

Sequence:  226186.BT_3853
Domain Number - Region: 25-193
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00229
Family Laminin G-like module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 226186.BT_3853
Sequence length 857
Comment (Bacteroides thetaiotaomicron VPI-5482)
Sequence
MIVTMKCRYLLSLVFLLHIWVCKSNVIDNSVYDYGLTFLAHSTNQDQRTNLDLTPAASLS
FPEDGFSVGFDIKLRNELYTYGYVVRVIADDSSCFDFISYLLYSRFNIVLTDKDRVIKNT
EIADSVKIVADRWIHVDLQFAKDRIHIAADGIQAEINHSLSNFKDIKIYFGGSKHPRFFS
TDVPPMTIRNIELADIQGKLLYKWELAAHDKDVTYDSVRNKQAFVRNGVWEIDKHTKWAA
LASLNVHHINPQVAYDDVSGRFFIAGGGQLFVYDVKANRIDSIAYKGHPYIGASSQIIFD
AKRNRLLSYTPDFNDLNVYEFDRKCWTLETPVMIDTRQHHNRIINQKRDELIVFGGYGNH
RYNSQLSRINLSDPQGWSISSLDSCLFPRYLSAMGAENEDYLLIMGGYGNQSGKQEESPG
NFYDLYRLNLKTGKCTKLWEFVNDRQHFTFGNSMIIDTPSNSVYALTYNNDRYNTFVYLS
RFDIQTRQPVQEVMSDSIVYNFLDIHSYCDMFLHKETSSIYAVVLQEKEPGISKVEFYKL
AFPPLSKEDILPHQTGGMKPVILISGILAGLLCLIGGSIWLLHSKRKRKVNVAVGPVATE
EVKDRSVEEEPTEQKVSSVLLLGGFQVFDKQGGNITGDFTPTLKQLFLFLLLNTIKNGKG
TTSQCLDETFWFDMSKSSASNNRNVNIRKLRLIIEKIGDINIANKNGYWYLNLGKDVTCD
YQEVMRLLDQIKDTITDKKIINKIISLASAGALLPNVSAEWIDEYKSAYYVLLTEILLSV
VNRPDIKEDSRLLLKISDVILLVDNIDEDAIRTKCRVLYQMGQKGLSKQSFDKFCIEYER
LLNAKPDFSYDDIINSL
Download sequence
Identical sequences A0A1H5ZRS0 C6IM46 Q8A118
226186.BT_3853 gi|29349261|ref|NP_812764.1| NP_812764.1.73244 WP_008764126.1.24025 WP_008764126.1.28290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]