SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 226186.BT_4417 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  226186.BT_4417
Domain Number 1 Region: 304-461
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.4e-27
Family HD domain 0.035
Further Details:      
 
Domain Number 2 Region: 197-294
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.74e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 226186.BT_4417
Sequence length 511
Comment (Bacteroides thetaiotaomicron VPI-5482)
Sequence
MIAIIATAIACFVVGGILSYVLFRYVLKSKYDSVLKDAETEAEVIKKNKLLEVKEKFLNK
KADLEKEVALRNQKIQQAENKLKQREMVLSQRQEEIQRKKLEAEAVKENLEAQLVIVDKK
KEELDKLQHQEIEKLEAISGLSADEAKERLVESLKEEAKTQAQSFINDIMDDAKLTASKE
AKRIVIQSIQRVATETAIENSVTVFHIESDEIKGRIIGREGRNIRALEAATGVEIVVDDT
PEAIVLSAFDPVRREIARLALHQLVTDGRIHPARIEEVVSKVRKQVEEEIIETGKRTTID
LGIHGLHPELIRIIGKMKYRSSYGQNLLQHARETANLCAVMASELGLNPKKAKRAGLLHD
IGKVPDEEPELPHALLGMKLAEKYKEKPDICNAIGAHHDETEMTSLLAPIVQVCDAISGA
RPGARREIVEAYIKRLNDLEQLAMAYPGVTKTYAIQAGRELRVIVGADKIDDKQTESLSG
EIAKKIQDEMTYPGQVKITVIRETRAVSFAK
Download sequence
Identical sequences A0A0P0FD59 A0A1H8D4I4 C6IL81 D7I8Z7 Q89ZG0 R7KSQ4 R9H9C8
NP_813328.1.73244 WP_008760083.1.19130 WP_008760083.1.24025 WP_008760083.1.28290 WP_008760083.1.29471 WP_008760083.1.52087 WP_008760083.1.54521 WP_008760083.1.58123 WP_008760083.1.59332 WP_008760083.1.59346 WP_008760083.1.67099 WP_008760083.1.83447 WP_008760083.1.97929 226186.BT_4417 BtR178 NYSGXRC-12042b gi|29349825|ref|NP_813328.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]