SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 226186.BT_4710 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  226186.BT_4710
Domain Number 1 Region: 182-354
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.52e-27
Family Pentraxin (pentaxin) 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 226186.BT_4710
Sequence length 402
Comment (Bacteroides thetaiotaomicron VPI-5482)
Sequence
MKTYIFKHSLLGVILGLSILGCTEGDKFDYNKNMAFITGTETTPVTKFVVEDTPSSYAVT
ASTTDKVDKDVNVKFAIDRSLVETYNNEHNTKYYAIPEGAVTLEDADAVIQAGKAFSTPA
TVKVISTEDFAEGRVYVVPVTMVEVDGLEILKPSKTIFLQISRVIHFTSLNISNTNLYSN
FIFSDDKKQELSNFTYEIKCYSQEWHRIARLCSFTSADEQRSSMLRFGENGLDINALQWV
SPSGSIVSSTRFSTDRWYMISLTYDGSKLTMYVDGVKDAQGDGDGKPVDFQRFELGMSWT
GYRGSQYFRGRIAEVRVWNRALSTGELQMNLCGVDSQSEGLVAYWKMNEGEGHIFKDATG
HGYDMDWTNTAREINEGAGLTYNLNYSSAIAWDSDDNNRCNE
Download sequence
Identical sequences A0A1H7XU36 Q89YM1 R7KKV2 R9H7T9
NP_813621.1.73244 WP_011109392.1.54521 WP_011109392.1.59346 WP_011109392.1.67099 226186.BT_4710 gi|29350118|ref|NP_813621.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]