SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 226900.BC0369 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  226900.BC0369
Domain Number - Region: 122-219
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0531
Family Reprolysin-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 226900.BC0369
Sequence length 235
Comment (Bacillus cereus ATCC14579)
Sequence
MVHTYLGETINFHITYKKKKSVRLFVDSYGNVEVQAPKGTPVEYLVQLLEEKWDWIQATR
KEMQERALGPQEKDYDQGEGFLYLGSTYPIQISQDASIEQDNAIFEGDKLHIYVKELKDE
KIQQALKRFYYKQCKSLVEKSIKAHQSNFKTKPRSIRITDSSRTWGTCDSNLQLTFNWKL
AMAPQRVIDYVVVHEMCHMVHLNHDRSFWRLVGKIMPDYKEMENWLALSSWKMTV
Download sequence
Identical sequences A0A0J6ZB83 B7H7C1 N1LY57 Q81IL7
226900.BC0369 405532.BCB4264_A0384 gi|30018577|ref|NP_830208.1| APC25286 BcR111 gi|218234122|ref|YP_002365165.1| NP_830208.1.86172 WP_000233742.1.10055 WP_000233742.1.14039 WP_000233742.1.26637 WP_000233742.1.39957 WP_000233742.1.47975 WP_000233742.1.57732 WP_000233742.1.58822 WP_000233742.1.60334 WP_000233742.1.63902 WP_000233742.1.67873 WP_000233742.1.73457 WP_000233742.1.73594 WP_000233742.1.76086 WP_000233742.1.76804 WP_000233742.1.76902 WP_000233742.1.81773 WP_000233742.1.88269 WP_000233742.1.90352 WP_000233742.1.95576 WP_000233742.1.97670 WP_000233742.1.99212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]