SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 226900.BC0410 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  226900.BC0410
Domain Number 1 Region: 17-141
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.63e-32
Family cAMP-binding domain 0.037
Further Details:      
 
Domain Number 2 Region: 144-221
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.58e-16
Family CAP C-terminal domain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 226900.BC0410
Sequence length 223
Comment (Bacillus cereus ATCC14579)
Sequence
MKDLKQFELFAHLTEKKLKGLTEFVYWRTYKKGQFLFLEGDSRERIYFMLDGFVKLERVN
QNGNLLYDDYVKRYSIFPYGGMFTDRGYNYTAEAMTDVEVYYIPTVIFEDMVKSSRTQLM
YVVQQLSSILKLNENRVQNITIPNAQDRVIQTLNYLMQDLGEQSGEKIVISCPLTTIEIS
KISGTSRETVSSVLKQLKNDSIVTILDKKITIHDPTYFEEISM
Download sequence
Identical sequences C2SVN9 C2WH78 C2X6L0 C3DYD2 Q814A3
NP_830249.1.86172 APC25290 226900.BC0410 gi|30018618|ref|NP_830249.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]