SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 226900.BC2370 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  226900.BC2370
Domain Number 1 Region: 35-197
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.82e-29
Family Beta-D-xylosidase C-terminal domain-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 226900.BC2370
Sequence length 198
Comment (Bacillus cereus ATCC14579)
Sequence
MNISYIPEHIEQLTIMNVPEYYKINDNHAFIVRSKAETDFWLKTHYGFEVMNGHVFYNEM
MTDFQAEVQLRMNPNSKFDQAGLFVMISENCWLKTSLEYIPEGPSHLGAVVTNNGYSDWS
TQDYPTEAAKQQLRFRIIRKRGDYTIYVKKRHQWEQIRIAHLMEDIGNEPIKIGFYTCSP
SKNKGFETEFLHFTIEEL
Download sequence
Identical sequences A0A0G4D390 A0A0T8IR17 A0A1S9YP26 J8I523 Q81DJ4 R8H9B3
226900.BC2370 NP_832132.1.86172 WP_001027672.1.14006 WP_001027672.1.14174 WP_001027672.1.21055 WP_001027672.1.24680 WP_001027672.1.26637 WP_001027672.1.28237 WP_001027672.1.33717 WP_001027672.1.38345 WP_001027672.1.44956 WP_001027672.1.46326 WP_001027672.1.58822 WP_001027672.1.59058 WP_001027672.1.60153 WP_001027672.1.76155 WP_001027672.1.76902 WP_001027672.1.80649 WP_001027672.1.93683 WP_001027672.1.97262 WP_001027672.1.97842 WP_001027672.1.98604 BcR24 gi|30020501|ref|NP_832132.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]