SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 227377.CBU_0531 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  227377.CBU_0531
Domain Number 1 Region: 6-230
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.74e-69
Family Decarboxylase 0.00000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 227377.CBU_0531
Sequence length 236
Comment (Coxiella burnetii)
Sequence
MEKPDPKVIVAIDAGTVEQARAQINPLTPELCHLKIGSILFTRYGPAFVEELMQKGYRIF
LDLKFYDIPQTVAGACRAVAELGVWMMNIHISGGRTMMETVVNALQSITLKEKPLLIGVT
ILTSLDGSDLKTLGIQEKVPDIVCRMATLAKSAGLDGVVCSAQEAALLRKQFDRNFLLVT
PGIRLETDEKGDQKRVMTPRAAIQAGSDYLVIGRPITQSTDPLKALEAIDKDIKTR
Download sequence
Identical sequences A0A2K2DWM5 A9KCT0 A9NC23 B6J1D4 B6J887 Q83E06
gi|212212971|ref|YP_002303907.1| gi|161831310|ref|YP_001596463.1| gi|212218844|ref|YP_002305631.1| NP_819563.1.72601 WP_005771152.1.11896 WP_005771152.1.15899 WP_005771152.1.18645 WP_005771152.1.18990 WP_005771152.1.20088 WP_005771152.1.25364 WP_005771152.1.29693 WP_005771152.1.31144 WP_005771152.1.35092 WP_005771152.1.38839 WP_005771152.1.39746 WP_005771152.1.41753 WP_005771152.1.43615 WP_005771152.1.460 WP_005771152.1.513 WP_005771152.1.53098 WP_005771152.1.55037 WP_005771152.1.55635 WP_005771152.1.56161 WP_005771152.1.57074 WP_005771152.1.6787 WP_005771152.1.68745 WP_005771152.1.68840 WP_005771152.1.72017 WP_005771152.1.7296 WP_005771152.1.73073 WP_005771152.1.74283 WP_005771152.1.85884 WP_005771152.1.88235 WP_005771152.1.8942 WP_005771152.1.92481 WP_005771152.1.96664 WP_005771152.1.9866 WP_005771152.1.99156 gi|29653871|ref|NP_819563.1| gi|154706773|ref|YP_001424876.1| 227377.CBU_0531 360115.COXBURSA331_A0645 434922.CBUD_1532 434923.CbuG_1463 434924.CbuK_1305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]