SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 227882.SAV_1207 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  227882.SAV_1207
Domain Number 1 Region: 3-170
Classification Level Classification E-value
Superfamily Flavoproteins 9.47e-32
Family NADPH-dependent FMN reductase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 227882.SAV_1207
Sequence length 184
Comment (Streptomyces avermitilis)
Sequence
MATVLSVSGSPSVSSRTNRLLRHLDTRLVAQGHEVIPLDVRTIPAEALLGADFRHPAIVE
ATELFARVDGVVIGTPVYKAAYSGVLKALLDLLPQYALTGKTVLPLATGGTTAHVLAIDY
ALRPVLNSMGAAHIVQGWFTLDKDITAGEDGSLTVAPAAAEALTQVVDQFSAALGRTPLL
AAAG
Download sequence
Identical sequences Q82NT4
gi|29827748|ref|NP_822382.1| WP_010982645.1.19017 WP_010982645.1.30226 WP_010982645.1.49792 WP_010982645.1.60620 WP_010982645.1.68722 227882.SAV_1207 SvR483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]