SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 227882.SAV_6618 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  227882.SAV_6618
Domain Number - Region: 32-105
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0125
Family Calponin-homology domain, CH-domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 227882.SAV_6618
Sequence length 130
Comment (Streptomyces avermitilis)
Sequence
MIEFARNVRLWFAPQEVRKVGGTPDYRFSLANERTFLAWLRTALALIGGGFAVDQFLPDL
RWGWRVGLALALLAAGVLCSLRAVNHWVRCEQAMRRGEDLPVSRFPALLSIAVAVVAIAM
VLVVLVGWEG
Download sequence
Identical sequences Q828P4
GO.6844 gi|29833160|ref|NP_827794.1| 227882.SAV_6618 WP_010988019.1.19017 WP_010988019.1.30226 WP_010988019.1.49792 WP_010988019.1.60620 WP_010988019.1.68722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]