SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 228400.HSM_1648 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  228400.HSM_1648
Domain Number - Region: 39-116
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0137
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 228400.HSM_1648
Sequence length 130
Comment (Haemophilus somnus 2336)
Sequence
MINKRWFKIIFLVMILLNIAIFYKINSNNYHEALLGRALVLKDIIEKYEKENGKLPESLH
CCLSGLKPTAKEMYVFPLDIDDSLAFIHEYDYIEDRYMLIIGDRYPPNLIYIYDTKELIF
DSDLISNFGL
Download sequence
Identical sequences B0UVC4
WP_012340776.1.21933 WP_012340776.1.3141 WP_012340776.1.31663 WP_012340776.1.32721 WP_012340776.1.4486 WP_012340776.1.51051 WP_012340776.1.71281 WP_012340776.1.72297 WP_012340776.1.80424 WP_012340776.1.8746 WP_012340776.1.92579 gi|170717916|ref|YP_001784968.1| 228400.HSM_1648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]