SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 228405.HNE_2652 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  228405.HNE_2652
Domain Number 1 Region: 56-266
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.47e-38
Family Glycosyl hydrolases family 16 0.0000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 228405.HNE_2652
Sequence length 294
Comment (Hyphomonas neptunium ATCC 15444)
Sequence
MRLGAVLGITAIGILGAVIFAGPVSSSEQEIGAPLPVSEVPQYEHPPQIAPDAEAGASFL
QHFSKDHDPTRWHKSNLSYPGAHPAWLSRQIHFFDDRVELELRRMRVGDKTLAGAEYQRR
GFYSFGRFEVVMTPAPGSGTVSSLFTHTHAQFGDPHDEIDIEFLGKDLRMFAANYFTDGA
PHDTIPVRLPFDASEEIHLYAFEWEPDEIRWFVNDELVHTATAKDHPIPQSPSRIIISLW
SGSPAQYDWHGKPTFEDGTRAAFYCVSFQKTGDTTPQCSDTFDPVAANAAKTAN
Download sequence
Identical sequences A0A059FLE2 Q0BYV3
gi|114797300|ref|YP_761340.1| 228405.HNE_2652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]